Identification of the modified amino acid residue in the modified heme protein using LC/MS/MS
Posters | 2012 | ShimadzuInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesProteomics
ManufacturerShimadzu
Key wordsheme, modified, protein, amino, peptide, fragments, tryptic, residue, acid, digestion, obtained, mutant, identification, identified, ananysis, speed, scanning, hypnotics, using, peptidase, immonium, were, exhibiting, ion, scan, peaks, tryptophan, methionine, same, inserted, searched, constructed, analysed, digested, assigned, nexera, without, mapping, which, near, applicable, analytical, japan, original, transition, longer, previously, conditions, mass, switching
Similar PDF
Identification of the modified amino acid residue in the modified heme protein using LC/MS/MS
2012|Shimadzu|Applications
Identification of the modified amino acid residue in the modified heme protein using LC/MS/MS ASMS 2012 TP09-180 Yuki Ando1; Keiko Matsumoto2; Jun Watanabe2; Junko Iida2; Shun Hirota1 1 Nara Institute of Science and Technology, Nara, JAPAN 2 Shimadzu Corporation, Kyoto,…
Key words
heme, hememodified, modifiedprotein, proteinamino, aminopeptide, peptidemutant, mutantfragments, fragmentstryptic, trypticacid, aciddigestion, digestionresidue, residueobtained, obtainedidentification, identificationusefull, usefullananysis
Analysis of Proteins and Peptides using LC-MS
|Shimadzu|Applications
LAAN-A-LM-E012 SHIMADZU APPLICATION NEWS ● LIQUID CHROMATOGRAPHY MASS SPECTROMETRY No. C55 Analysis of Proteins and Peptides using LC-MS important process, and this is currently conducted using such technologies as peptide sequencing for amino acid analysis, HPLC for simple peptide mapping,…
Key words
cdl, cdlweight, weightvoltage, voltagemolecular, molecularmultiply, multiplyamino, aminopeptides, peptidespeptide, peptidenews, newsmass, masssequence, sequenceenzymatic, enzymaticylefisdaiihvlhskhpgdfgadaqgamtk, ylefisdaiihvlhskhpgdfgadaqgamtkglsdgewqqvlnvwgkveadiaghgqevlir, glsdgewqqvlnvwgkveadiaghgqevlircharged
Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis
2013|Shimadzu|Posters
PO-CON1362E Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis ASMS 2013 TP-756 Rachel Lieberman1, Brian Feild1, Kevin Meyer2, Nick Herold2, Scott Kuzdzal1, Kevin Meyer2, Nick Herold2 1 Shimadzu Scientific Instruments, Columbia, MD 2 Perfinity Biosciences, Inc., West Lafeyette,…
Key words
umtic, umticallergen, allergenovercoming, overcomingimer, imerprotein, proteinfood, foodtrypsin, trypsinmin, mindigestion, digestionchallenges, challengessample, sampleextract, extractsfnldeghalr, sfnldeghalrdesalting, desaltingperfinity
Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis
2013|Shimadzu|Posters
PO-CON1362E Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis ASMS 2013 TP-756 Rachel Lieberman1, Brian Feild1, Kevin Meyer2, Nick Herold2, Scott Kuzdzal1, Kevin Meyer2, Nick Herold2 1 Shimadzu Scientific Instruments, Columbia, MD 2 Perfinity Biosciences, Inc., West Lafeyette,…
Key words
umtic, umticallergen, allergenimer, imerovercoming, overcomingprotein, proteinfood, foodtrypsin, trypsinmin, mindigestion, digestionchallenges, challengessample, sampleextract, extractsfnldeghalr, sfnldeghalrperfinity, perfinitydesalting