Analysis of Proteins and Peptides using LC-MS
Applications | | ShimadzuInstrumentation
LC/MS, LC/SQ
IndustriesProteomics
ManufacturerShimadzu
Key wordscdl, weight, voltage, molecular, amino, multiply, peptides, peptide, news, mass, sequence, enzymatic, ylefisdaiihvlhskhpgdfgadaqgamtk, glsdgewqqvlnvwgkveadiaghgqevlir, charged, using, tpck, digestion, array, theoretical, conducted, acid, state, proteins, produced, composition, analysis, detergents, horse, novo, protein, effective, singly, myoglobin, proves, detected, calculated, from, edited, distinguished, medicines, sequencing, enzymes, quadrupole, recombinant, spectrometer, structurally, exceeds, mobile, expression
Similar PDF
Shimadzu Solutions for Biopharmaceutical - Application Notebook
2018|Shimadzu|Guides
C10G-E054 Solutions for Biopharmaceutical Application Notebook First Edition: December, 2017 © Shimadzu Corporation, 2017 Solutions for Biopharmaceutical Index Application Notebook Bioanalysis LCMS Bioanalysis of Antibody Drugs Using Fab-Selective Proteolysis nSMOL - Trastuzumab analysis nSMOL, which enables selective proteolysis of the…
Key words
acid, acidamino, aminoantibody, antibodyglycan, glycannsmol, nsmolerexim, ereximstructure, structurenews, newsaggregates, aggregatesnucleic, nucleicanalysis, analysismrm, mrmglycans, glycanssizer, sizeraggregate
Identification of the modified amino acid residue in the modified heme protein using LC/MS/MS
2012|Shimadzu|Applications
Identification of the modified amino acid residue in the modified heme protein using LC/MS/MS ASMS 2012 TP09-180 Yuki Ando1; Keiko Matsumoto2; Jun Watanabe2; Junko Iida2; Shun Hirota1 1 Nara Institute of Science and Technology, Nara, JAPAN 2 Shimadzu Corporation, Kyoto,…
Key words
heme, hememodified, modifiedprotein, proteinamino, aminopeptide, peptidemutant, mutantfragments, fragmentstryptic, trypticacid, aciddigestion, digestionresidue, residueobtained, obtainedusefull, usefullidentification, identificationananysis
Identification of the modified amino acid residue in the modified heme protein using LC/MS/MS
2012|Shimadzu|Posters
PO-CON1209E Identification of the modified amino acid residue in the modified heme protein using LC/MS/MS IMSC 2012 PMo-126 Yuki Ando1; Keiko Matsumoto2; Jun Watanabe2; Junko Iida2; Shun Hirota1 1Nara Institute of Science and Technology, Nara, JAPAN 1 Nara Institute of…
Key words
heme, hememodified, modifiedprotein, proteinamino, aminopeptide, peptidefragments, fragmentstryptic, trypticresidue, residueacid, aciddigestion, digestionobtained, obtainedmutant, mutantidentification, identificationidentified, identifiedananysis
Biomolecule Purification, Characterization, and Analysis
2019|Waters|Brochures and specifications
Biomolecule Purification, Characterization, and Analysis Innovative Technologies from the Leader in Separation Science and Analytical Biochemistry Advances in the areas of genomics, proteomics, metabolomics, and molecular and system biology continue to revolutionize the diagnosis and treatment of diseases and increase…
Key words
protein, proteinaccq, accquplc, uplctag, tagdimension, dimensioncolumn, columnpeptide, peptidemab, mabpak, pakcolumns, columnsacquity, acquitymassprep, massprepamino, aminoordering, orderingglycoworks