Login
LabRulez
Registration
Settings
Filter
Filter
Password reset
Password reset
 

Similar PDF

PO-CON1209EIdentification of the modifiedamino acid residue in themodified heme protein usingLC/MS/MSIMSC 2012PMo-126Yuki Ando1; Keiko Matsumoto2; Jun Watanabe2;Junko Iida2; Shun Hirota1 1Nara Institute of Scienceand Technology, Nara, JAPAN1Nara Institute of Science and Technology, Nara,JAPAN2Shimadzu Corporation, Kyoto, JAPAN Identification of the modified amino...
Key words
heme, hememodified, modifiedprotein, proteinamino, aminopeptide, peptidefragments, fragmentstryptic, trypticresidue, residuedigestion, digestionacid, acidobtained, obtainedmutant, mutantidentification, identificationidentified, identifiedananysis
PO-CON1362EOvercoming Challenges ofProtein Sample Preparation forFood Allergen AnalysisASMS 2013TP-756Rachel Lieberman1, Brian Feild1, Kevin Meyer2,Nick Herold2, Scott Kuzdzal1, Kevin Meyer2, NickHerold21Shimadzu Scientific Instruments, Columbia, MD2Perfinity Biosciences, Inc., West Lafeyette, IN Overcoming Challenges of Protein Sample Preparation forFood Allergen Analysis1.OverviewAn on-line sample preparation...
Key words
umtic, umticallergen, allergenovercoming, overcomingprotein, proteinimer, imertrypsin, trypsinfood, foodmin, mindigestion, digestionchallenges, challengessample, sampleextract, extractsfnldeghalr, sfnldeghalrdesalting, desaltingpreparation
LAAN-A-LM-E012SHIMADZU APPLICATION NEWS● LIQUID CHROMATOGRAPHY MASS SPECTROMETRYNo.C55Analysis of Proteins and Peptides using LC-MSimportant process, and this is currently conductedusing such technologies as peptide sequencing foramino acid analysis, HPLC for simple peptidemapping, and MALDI-TOFMS for mass mapping, etc.This Application News introduces...
Key words
cdl, cdlweight, weightvoltage, voltagemolecular, molecularamino, aminomultiply, multiplypeptides, peptidesnews, newspeptide, peptidesequence, sequenceenzymatic, enzymaticmass, massylefisdaiihvlhskhpgdfgadaqgamtk, ylefisdaiihvlhskhpgdfgadaqgamtkdigestion, digestionglsdgewqqvlnvwgkveadiaghgqevlir
PO-CON1362EOvercoming Challenges ofProtein Sample Preparation forFood Allergen AnalysisASMS 2013TP-756Rachel Lieberman1, Brian Feild1, Kevin Meyer2,Nick Herold2, Scott Kuzdzal1, Kevin Meyer2, NickHerold21Shimadzu Scientific Instruments, Columbia, MD2Perfinity Biosciences, Inc., West Lafeyette, IN Overcoming Challenges of Protein Sample Preparation forFood Allergen Analysis1.OverviewAn on-line sample preparation...
Key words
umtic, umticallergen, allergenovercoming, overcomingprotein, proteinimer, imertrypsin, trypsinfood, foodmin, mindigestion, digestionchallenges, challengessample, sampleextract, extractsfnldeghalr, sfnldeghalrdesalting, desaltingpreparation
 

Similar PDF

PO-CON1209EIdentification of the modifiedamino acid residue in themodified heme protein usingLC/MS/MSIMSC 2012PMo-126Yuki Ando1; Keiko Matsumoto2; Jun Watanabe2;Junko Iida2; Shun Hirota1 1Nara Institute of Scienceand Technology, Nara, JAPAN1Nara Institute of Science and Technology, Nara,JAPAN2Shimadzu Corporation, Kyoto, JAPAN Identification of the modified amino...
Key words
heme, hememodified, modifiedprotein, proteinamino, aminopeptide, peptidefragments, fragmentstryptic, trypticresidue, residuedigestion, digestionacid, acidobtained, obtainedmutant, mutantidentification, identificationidentified, identifiedananysis
PO-CON1362EOvercoming Challenges ofProtein Sample Preparation forFood Allergen AnalysisASMS 2013TP-756Rachel Lieberman1, Brian Feild1, Kevin Meyer2,Nick Herold2, Scott Kuzdzal1, Kevin Meyer2, NickHerold21Shimadzu Scientific Instruments, Columbia, MD2Perfinity Biosciences, Inc., West Lafeyette, IN Overcoming Challenges of Protein Sample Preparation forFood Allergen Analysis1.OverviewAn on-line sample preparation...
Key words
umtic, umticallergen, allergenovercoming, overcomingprotein, proteinimer, imertrypsin, trypsinfood, foodmin, mindigestion, digestionchallenges, challengessample, sampleextract, extractsfnldeghalr, sfnldeghalrdesalting, desaltingpreparation
LAAN-A-LM-E012SHIMADZU APPLICATION NEWS● LIQUID CHROMATOGRAPHY MASS SPECTROMETRYNo.C55Analysis of Proteins and Peptides using LC-MSimportant process, and this is currently conductedusing such technologies as peptide sequencing foramino acid analysis, HPLC for simple peptidemapping, and MALDI-TOFMS for mass mapping, etc.This Application News introduces...
Key words
cdl, cdlweight, weightvoltage, voltagemolecular, molecularamino, aminomultiply, multiplypeptides, peptidesnews, newspeptide, peptidesequence, sequenceenzymatic, enzymaticmass, massylefisdaiihvlhskhpgdfgadaqgamtk, ylefisdaiihvlhskhpgdfgadaqgamtkdigestion, digestionglsdgewqqvlnvwgkveadiaghgqevlir
PO-CON1362EOvercoming Challenges ofProtein Sample Preparation forFood Allergen AnalysisASMS 2013TP-756Rachel Lieberman1, Brian Feild1, Kevin Meyer2,Nick Herold2, Scott Kuzdzal1, Kevin Meyer2, NickHerold21Shimadzu Scientific Instruments, Columbia, MD2Perfinity Biosciences, Inc., West Lafeyette, IN Overcoming Challenges of Protein Sample Preparation forFood Allergen Analysis1.OverviewAn on-line sample preparation...
Key words
umtic, umticallergen, allergenovercoming, overcomingprotein, proteinimer, imertrypsin, trypsinfood, foodmin, mindigestion, digestionchallenges, challengessample, sampleextract, extractsfnldeghalr, sfnldeghalrdesalting, desaltingpreparation
 

Related content

Quantitation of Pesticide Residues in Milk Using the Agilent 6470 Triple Quadrupole LC/MS

Aplikace
| 2021 | Agilent Technologies
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Potraviny a zemědělství

Utilization of the ACQUITY PREMIER System and Column for Improved Oligonucleotide Bioanalytical Chromatographic Performance

Aplikace
| 2021 | Waters
Instrumentation
Consumables, LC/MS, LC/MS/MS, LC columns, LC/QQQ
Manufacturer
Waters
Industries
Clinical Research

Development of Profiling Method for Major Lipids in Blood by Triple Quadrupole LC/MS/MS

Aplikace
| 2021 | Shimadzu
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Shimadzu
Industries
Clinical Research
 

Related content

Quantitation of Pesticide Residues in Milk Using the Agilent 6470 Triple Quadrupole LC/MS

Aplikace
| 2021 | Agilent Technologies
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Potraviny a zemědělství

Utilization of the ACQUITY PREMIER System and Column for Improved Oligonucleotide Bioanalytical Chromatographic Performance

Aplikace
| 2021 | Waters
Instrumentation
Consumables, LC/MS, LC/MS/MS, LC columns, LC/QQQ
Manufacturer
Waters
Industries
Clinical Research

Development of Profiling Method for Major Lipids in Blood by Triple Quadrupole LC/MS/MS

Aplikace
| 2021 | Shimadzu
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Shimadzu
Industries
Clinical Research
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use

LabRulez s.r.o., all rights reserved.