Identification of the modified amino acid residue in the modified heme protein using LC/MS/MS
Applications | 2012 | ShimadzuInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesProteomics
ManufacturerShimadzu
Key wordsheme, modified, protein, amino, peptide, mutant, fragments, tryptic, acid, digestion, residue, obtained, identification, usefull, ananysis, speed, scanning, peptidase, immonium, using, exhibiting, ion, spectrometer, tryptophan, methionine, inserted, constructed, product, analysed, digested, nexera, without, mapping, near, analytical, japan, original, longer, conditions, mass, switching, sequence, carried, polarity, showed, capacity, warranties, limitation, kind, warranty
Similar PDF
Identification of the modified amino acid residue in the modified heme protein using LC/MS/MS
2012|Shimadzu|Posters
PO-CON1209E Identification of the modified amino acid residue in the modified heme protein using LC/MS/MS IMSC 2012 PMo-126 Yuki Ando1; Keiko Matsumoto2; Jun Watanabe2; Junko Iida2; Shun Hirota1 1Nara Institute of Science and Technology, Nara, JAPAN 1 Nara Institute of…
Key words
heme, hememodified, modifiedprotein, proteinamino, aminopeptide, peptidefragments, fragmentstryptic, trypticresidue, residueacid, aciddigestion, digestionobtained, obtainedmutant, mutantidentification, identificationidentified, identifiedananysis
Analysis of Proteins and Peptides using LC-MS
|Shimadzu|Applications
LAAN-A-LM-E012 SHIMADZU APPLICATION NEWS ● LIQUID CHROMATOGRAPHY MASS SPECTROMETRY No. C55 Analysis of Proteins and Peptides using LC-MS important process, and this is currently conducted using such technologies as peptide sequencing for amino acid analysis, HPLC for simple peptide mapping,…
Key words
cdl, cdlweight, weightvoltage, voltagemolecular, molecularmultiply, multiplyamino, aminopeptides, peptidespeptide, peptidenews, newsmass, masssequence, sequenceenzymatic, enzymaticylefisdaiihvlhskhpgdfgadaqgamtk, ylefisdaiihvlhskhpgdfgadaqgamtkglsdgewqqvlnvwgkveadiaghgqevlir, glsdgewqqvlnvwgkveadiaghgqevlirusing
Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis
2013|Shimadzu|Posters
PO-CON1362E Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis ASMS 2013 TP-756 Rachel Lieberman1, Brian Feild1, Kevin Meyer2, Nick Herold2, Scott Kuzdzal1, Kevin Meyer2, Nick Herold2 1 Shimadzu Scientific Instruments, Columbia, MD 2 Perfinity Biosciences, Inc., West Lafeyette,…
Key words
umtic, umticallergen, allergenimer, imerovercoming, overcomingprotein, proteinfood, foodtrypsin, trypsinmin, mindigestion, digestionchallenges, challengessample, sampleextract, extractsfnldeghalr, sfnldeghalrperfinity, perfinitydesalting
Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis
2013|Shimadzu|Posters
PO-CON1362E Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis ASMS 2013 TP-756 Rachel Lieberman1, Brian Feild1, Kevin Meyer2, Nick Herold2, Scott Kuzdzal1, Kevin Meyer2, Nick Herold2 1 Shimadzu Scientific Instruments, Columbia, MD 2 Perfinity Biosciences, Inc., West Lafeyette,…
Key words
umtic, umticallergen, allergenovercoming, overcomingimer, imerprotein, proteinfood, foodtrypsin, trypsinmin, mindigestion, digestionchallenges, challengessample, sampleextract, extractsfnldeghalr, sfnldeghalrperfinity, perfinitydesalting