Structural Analysis of the Multimers of Bovine Serum Albumin by Ion Mobility Mass Spectrometry | LabRulez LCMS
 

Similar PDF

Toggle
Application NoteBiologicsExamining the Structural Influenceof Site-Specific Phosphorylation byIon Mobility Mass SpectrometryAuthorsRebecca S. Glaskin,Caroline S. Chu, andDawn M. StickleAgilent Technologies, Inc.AbstractThis application note describes an automated workflow for the analysis of proteinphosphorylation from sample preparation with phosphopeptide enrichment toanalysis by ion...
Key words
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikfqseeqqqtedelqdk, fqseeqqqtedelqdkccs, ccscharge, chargephosphorylation, phosphorylationnavpitptlnreqlstseenskk, navpitptlnreqlstseenskkmass, masssequence, sequencepeptides, peptidesekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper, ntppsqhshpsiqhsperphosphopeptides
ADD A NEW DIMENSION TO YOURRESEARCH WITH THE AGILENT 6560 IONMOBILITY Q-TOF LC/MSThe Measure of ConfidenceKen ImataniAgilent Q-TOF LC/MSProduct ManagerDavid Wong, Ph.D.Senior Application ScientistApplications HighlightsThe Agilent 6560 Ion Mobility Q-TOF LC/MS system is the first commerciallyavailable uniform field ion mobility...
Key words
drift, driftcounts, countscharge, chargemobility, mobilitymass, massexamples, examplesconformations, conformationsspecificity, specificityspectrum, spectrumtime, timeion, iondifucohexaose, difucohexaosepreserve, preservestructural, structurallacto
Technical OverviewAssuring the Integrity of Biologicals inHigh-Intensity UV DetectorsAuthorMarkus ArendtAgilent Technologies, Inc.IntroductionThe demand for more sensitive UV detectors to lower detection limits furthercomes with a drawback. Higher sensitivity often means higher intensity of the lightthat analytes are exposed to. For...
Key words
charge, chargecounts, countsaperture, aperturephotodegradation, photodegradationlight, lightintensity, intensitymass, massµau, µaudetection, detectiondetectors, detectorsoff, offdetector, detectorenvelope, envelopelimits, limitsinfluences
Agilent BiocolumnsAggregate/Fragment AnalysisApplication Compendium ContentsBackground2Getting Started3How to Guide - Size Exclusion Chromatography for BiomoleculeAnalysis - 5991-3651EN 4Featured Application NotesElevate Your mAb Aggregate Analysis - 5994-2709EN12222High-Resolution, High-Throughput Size Exclusion ChromatographyAnalysis of Monoclonal Antibodies - 5994-0828EN29Sensitive Native Mass Spectrometry of MacromoleculesUsing Standard Flow LC/MS...
Key words
return, returnsection, sectionmau, maucontents, contentssec, secinsulin, insulinmin, minsize, sizeprotein, proteinmonomer, monomeradvancebio, advancebiotime, timeexclusion, exclusionaggregates, aggregatesaggregate
 

Similar PDF

Toggle
Application NoteBiologicsExamining the Structural Influenceof Site-Specific Phosphorylation byIon Mobility Mass SpectrometryAuthorsRebecca S. Glaskin,Caroline S. Chu, andDawn M. StickleAgilent Technologies, Inc.AbstractThis application note describes an automated workflow for the analysis of proteinphosphorylation from sample preparation with phosphopeptide enrichment toanalysis by ion...
Key words
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikfqseeqqqtedelqdk, fqseeqqqtedelqdkccs, ccscharge, chargephosphorylation, phosphorylationnavpitptlnreqlstseenskk, navpitptlnreqlstseenskkmass, masssequence, sequencepeptides, peptidesekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper, ntppsqhshpsiqhsperphosphopeptides
ADD A NEW DIMENSION TO YOURRESEARCH WITH THE AGILENT 6560 IONMOBILITY Q-TOF LC/MSThe Measure of ConfidenceKen ImataniAgilent Q-TOF LC/MSProduct ManagerDavid Wong, Ph.D.Senior Application ScientistApplications HighlightsThe Agilent 6560 Ion Mobility Q-TOF LC/MS system is the first commerciallyavailable uniform field ion mobility...
Key words
drift, driftcounts, countscharge, chargemobility, mobilitymass, massexamples, examplesconformations, conformationsspecificity, specificityspectrum, spectrumtime, timeion, iondifucohexaose, difucohexaosepreserve, preservestructural, structurallacto
Technical OverviewAssuring the Integrity of Biologicals inHigh-Intensity UV DetectorsAuthorMarkus ArendtAgilent Technologies, Inc.IntroductionThe demand for more sensitive UV detectors to lower detection limits furthercomes with a drawback. Higher sensitivity often means higher intensity of the lightthat analytes are exposed to. For...
Key words
charge, chargecounts, countsaperture, aperturephotodegradation, photodegradationlight, lightintensity, intensitymass, massµau, µaudetection, detectiondetectors, detectorsoff, offdetector, detectorenvelope, envelopelimits, limitsinfluences
Agilent BiocolumnsAggregate/Fragment AnalysisApplication Compendium ContentsBackground2Getting Started3How to Guide - Size Exclusion Chromatography for BiomoleculeAnalysis - 5991-3651EN 4Featured Application NotesElevate Your mAb Aggregate Analysis - 5994-2709EN12222High-Resolution, High-Throughput Size Exclusion ChromatographyAnalysis of Monoclonal Antibodies - 5994-0828EN29Sensitive Native Mass Spectrometry of MacromoleculesUsing Standard Flow LC/MS...
Key words
return, returnsection, sectionmau, maucontents, contentssec, secinsulin, insulinmin, minsize, sizeprotein, proteinmonomer, monomeradvancebio, advancebiotime, timeexclusion, exclusionaggregates, aggregatesaggregate
 

Related content

Simultaneous analysis of drug substances according to USP assay and impurity methods

Applications
| 2022 | Thermo Fischer Scientific
Instrumentation
HPLC
Manufacturer
Thermo Fischer Scientific
Industries
Pharma & Biopharma

Matrix Matching or Isotope Dilution? A Comparison of Two Quantitation Approaches to Determine PFAS in Dairy Milk

Applications
| 2022 | Waters
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Waters
Industries
Food & Agriculture

Food Metabolomics of Alcoholic Beverage Using Single-Quadrupole Mass Spectrometer — Oligosaccharide and Polysaccharide Profiling —

Applications
| 2022 | Shimadzu
Instrumentation
LC/MS, LC/SQ
Manufacturer
Shimadzu
Industries
Food & Agriculture

Demonstrating the Applicability of the ACQUITY™ Premier Binary System for Long Shallow Gradient Peptide Mapping Analysis

Applications
| 2022 | Waters
Instrumentation
HPLC
Manufacturer
Waters
Industries
Proteomics

Qualitative Analysis of the Components in Foods Using DART and the Quadrupole Time- of-flight Mass Spectrometer

Applications
| 2022 | Shimadzu
Instrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, DART
Manufacturer
Shimadzu
Industries
Food & Agriculture
 

Related content

Simultaneous analysis of drug substances according to USP assay and impurity methods

Applications
| 2022 | Thermo Fischer Scientific
Instrumentation
HPLC
Manufacturer
Thermo Fischer Scientific
Industries
Pharma & Biopharma

Matrix Matching or Isotope Dilution? A Comparison of Two Quantitation Approaches to Determine PFAS in Dairy Milk

Applications
| 2022 | Waters
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Waters
Industries
Food & Agriculture

Food Metabolomics of Alcoholic Beverage Using Single-Quadrupole Mass Spectrometer — Oligosaccharide and Polysaccharide Profiling —

Applications
| 2022 | Shimadzu
Instrumentation
LC/MS, LC/SQ
Manufacturer
Shimadzu
Industries
Food & Agriculture

Demonstrating the Applicability of the ACQUITY™ Premier Binary System for Long Shallow Gradient Peptide Mapping Analysis

Applications
| 2022 | Waters
Instrumentation
HPLC
Manufacturer
Waters
Industries
Proteomics

Qualitative Analysis of the Components in Foods Using DART and the Quadrupole Time- of-flight Mass Spectrometer

Applications
| 2022 | Shimadzu
Instrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, DART
Manufacturer
Shimadzu
Industries
Food & Agriculture
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use

LabRulez s.r.o., all rights reserved.