Structural Analysis of the Multimers of Bovine Serum Albumin by Ion Mobility Mass Spectrometry
Applications | 2020 | Agilent TechnologiesInstrumentation
Ion Mobility, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Key wordsdrift, counts, charge, multimers, mass, heat, corresponding, time, trendlines, maps, dimer, bsa, funnel, states, adopt, conformational, albumin, larger, times, spread, complexes, obtained, bovine, monomer, nonoverlapping, tube, show, comparison, trapping, mobility, two, serum, dimensional, versus, formation, multimeric, ibc, correspondingly, higher, impressions, given, field, spectrometry, faster, pulser, conditions, tetramer, evidenced, accounted, across
Similar PDF
Examining the Structural Influence of Site-Specific Phosphorylation by Ion Mobility Mass Spectrometry
2019|Agilent Technologies|Applications
Application NoteBiologicsExamining the Structural Influenceof Site-Specific Phosphorylation byIon Mobility Mass SpectrometryAuthorsRebecca S. Glaskin,Caroline S. Chu, andDawn M. StickleAgilent Technologies, Inc.AbstractThis application note describes an automated workflow for the analysis of proteinphosphorylation from sample preparation with phosphopeptide enrichment toanalysis by ion...
Key words
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikfqseeqqqtedelqdk, fqseeqqqtedelqdkccs, ccscharge, chargephosphorylation, phosphorylationnavpitptlnreqlstseenskk, navpitptlnreqlstseenskkmass, massekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper, ntppsqhshpsiqhspersequence, sequencepeptides, peptidesphosphopeptides
ADD A NEW DIMENSION TO YOUR RESEARCH WITH THE AGILENT 6560 ION MOBILITY Q-TOF LC/MS
2015|Agilent Technologies|Technical notes
ADD A NEW DIMENSION TO YOURRESEARCH WITH THE AGILENT 6560 IONMOBILITY Q-TOF LC/MSThe Measure of ConfidenceKen ImataniAgilent Q-TOF LC/MSProduct ManagerDavid Wong, Ph.D.Senior Application ScientistApplications HighlightsThe Agilent 6560 Ion Mobility Q-TOF LC/MS system is the first commerciallyavailable uniform field ion mobility...
Key words
drift, driftcounts, countscharge, chargemobility, mobilitymass, massexamples, examplesconformations, conformationsspecificity, specificityspectrum, spectrumtime, timeion, iondifucohexaose, difucohexaosepreserve, preservestructural, structurallacto
Assuring the Integrity of Biologicals in High-Intensity UV Detectors
2021|Agilent Technologies|Technical notes
Technical OverviewAssuring the Integrity of Biologicals inHigh-Intensity UV DetectorsAuthorMarkus ArendtAgilent Technologies, Inc.IntroductionThe demand for more sensitive UV detectors to lower detection limits furthercomes with a drawback. Higher sensitivity often means higher intensity of the lightthat analytes are exposed to. For...
Key words
charge, chargecounts, countsaperture, aperturephotodegradation, photodegradationlight, lightintensity, intensitymass, massµau, µaudetection, detectiondetectors, detectorsoff, offdetector, detectorenvelope, envelopelimits, limitsinfluences
Agilent Biocolumns - Aggregate/Fragment Analysis - Application Compendium
2021|Agilent Technologies|Guides
Agilent BiocolumnsAggregate/Fragment AnalysisApplication Compendium ContentsBackground2Getting Started3How to Guide - Size Exclusion Chromatography for BiomoleculeAnalysis - 5991-3651EN 4Featured Application NotesElevate Your mAb Aggregate Analysis - 5994-2709EN12222High-Resolution, High-Throughput Size Exclusion ChromatographyAnalysis of Monoclonal Antibodies - 5994-0828EN29Sensitive Native Mass Spectrometry of MacromoleculesUsing Standard Flow LC/MS...
Key words
return, returnsection, sectioncontents, contentsmau, mausec, secinsulin, insulinmin, minprotein, proteinsize, sizemonomer, monomeradvancebio, advancebiotime, timeexclusion, exclusionaggregates, aggregatesaggregate