Structural Analysis of the Multimers of Bovine Serum Albumin by Ion Mobility Mass Spectrometry
Applications | 2020 | Agilent TechnologiesInstrumentation
Ion Mobility, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Key wordsdrift, counts, charge, multimers, mass, heat, corresponding, time, maps, trendlines, dimer, bsa, funnel, states, conformational, adopt, albumin, larger, times, complexes, spread, bovine, obtained, monomer, nonoverlapping, tube, show, mobility, comparison, trapping, two, serum, dimensional, ibc, multimeric, formation, versus, higher, impressions, correspondingly, given, field, spectrometry, conditions, faster, pulser, tetramer, evidenced, accounted, across
Similar PDF
ADD A NEW DIMENSION TO YOUR RESEARCH WITH THE AGILENT 6560 ION MOBILITY Q-TOF LC/MS
2015|Agilent Technologies|Technical notes
ADD A NEW DIMENSION TO YOUR RESEARCH WITH THE AGILENT 6560 ION MOBILITY Q-TOF LC/MS The Measure of Confidence Ken Imatani Agilent Q-TOF LC/MS Product Manager David Wong, Ph.D. Senior Application Scientist Applications Highlights The Agilent 6560 Ion Mobility Q-TOF…
Key words
drift, driftcounts, countscharge, chargemobility, mobilitymass, massexamples, examplesconformations, conformationsspecificity, specificityspectrum, spectrumtime, timeion, iondifucohexaose, difucohexaosepreserve, preservestructural, structurallacto
Examining the Structural Influence of Site-Specific Phosphorylation by Ion Mobility Mass Spectrometry
2019|Agilent Technologies|Applications
Application Note Biologics Examining the Structural Influence of Site-Specific Phosphorylation by Ion Mobility Mass Spectrometry Authors Rebecca S. Glaskin, Caroline S. Chu, and Dawn M. Stickle Agilent Technologies, Inc. Abstract This application note describes an automated workflow for the analysis…
Key words
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikfqseeqqqtedelqdk, fqseeqqqtedelqdkccs, ccscharge, chargephosphorylation, phosphorylationnavpitptlnreqlstseenskk, navpitptlnreqlstseenskkmass, massekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper, ntppsqhshpsiqhspersequence, sequencepeptides, peptidesrspypsrsr
Assuring the Integrity of Biologicals in High-Intensity UV Detectors
2021|Agilent Technologies|Technical notes
Technical Overview Assuring the Integrity of Biologicals in High-Intensity UV Detectors Author Markus Arendt Agilent Technologies, Inc. Introduction The demand for more sensitive UV detectors to lower detection limits further comes with a drawback. Higher sensitivity often means higher intensity…
Key words
charge, chargecounts, countsaperture, aperturephotodegradation, photodegradationlight, lightintensity, intensitymass, massµau, µaudetection, detectiondetectors, detectorsdetector, detectoroff, offenvelope, envelopelimits, limitsinfluences
Agilent 6560 Ion Mobility Q-TOF LC/MS System
2017|Agilent Technologies|Brochures and specifications
Agilent 6560 Ion Mobility Q-TOF LC/MS System ADD A NEW DIMENSION TO YOUR RESEARCH AGILENT 6560 ION MOBILITY Q-TOF LC/MS SYSTEM SEE WHAT YOU’VE BEEN MISSING Reveal More Details Than Ever Before Whether your research involves characterizing small molecules or…
Key words
drift, driftion, ionmobility, mobilityfunnel, funnelseparation, separationregion, regionccs, ccscharge, chargeanalysisanalysis, analysisanalysispanomics, panomicsyou, youprotein, proteinpeptides, peptidesextracted, extractedempirical