Human Breast Cancer Cell Line Phosphoproteome Revealed by an Automated and Highly Selective Enrichment Workflow
Applications | 2018 | Agilent TechnologiesInstrumentation
Sample Preparation, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerAgilent Technologies
Key wordsphosphopeptide, enrichment, phosphopeptides, found, phosphomix, yield, tklitqlrdak, imac, nta, peptides, unenriched, heavy, nanodapter, light, assaymap, sample, distinct, nanoesi, were, iii, water, adepsseesdleidk, total, mrm, phosphorylation, nanoflow, resin, skyline, phosphorylated, hydroxide, counts, bravo, phosphosite, automated, cartridges, standard, precursor, yes, isotope, number, acquisition, same, swissprot, time, affinity, carbamidomethylation, reproducible, peptide, ratio, assigned
Similar PDF
A Novel, Automated, and Highly Selective Phosphopeptide Enrichment for Phosphopeptide Identification and Phosphosite Localization
2020|Agilent Technologies|Applications
Application Note Proteomics A Novel, Automated, and Highly Selective Phosphopeptide Enrichment for Phosphopeptide Identification and Phosphosite Localization Authors Valery G. Voinov and Joseph S. Beckman e-MSion Inc. Corvallis, OR, USA Shuai Wu, Kenneth Newton, Linfeng Wu, and Jordy J. Hsiao…
Key words
phosphopeptide, phosphopeptidevveavnsdsdsefgipk, vveavnsdsdsefgipkphosphopeptides, phosphopeptidesenrichment, enrichmentyeast, yeastpeptide, peptideenriched, enrichedassaymap, assaymapecd, ecdnonphosphopeptide, nonphosphopeptidewere, werephosphorylation, phosphorylationphosphorylated, phosphorylatedphosphosite, phosphositeprecursor
Agilent AssayMAP Bravo Technology Enables Reproducible Automated Phosphopeptide Enrichment from Complex Mixtures Using High‑Capacity Fe(III)‑NTA Cartridges
2016|Agilent Technologies|Applications
Agilent AssayMAP Bravo Technology Enables Reproducible Automated Phosphopeptide Enrichment from Complex Mixtures Using High‑Capacity Fe(III)‑NTA Cartridges Application Note Automated Peptide Sample Preparation for LC/MS Authors Abstract Jason D. Russell and Steve Murphy Immobilized metal affinity chromatography (IMAC) using a nitrilotriacetic…
Key words
phosphopeptide, phosphopeptidephosphopeptides, phosphopeptidesenrichment, enrichmentassaymap, assaymapnta, ntaiii, iiiselectivity, selectivityidentifications, identificationscartridges, cartridgescasein, caseinimmobilized, immobilizeddistinct, distinctsample, samplecartridge, cartridgeimac
Examining the Structural Influence of Site-Specific Phosphorylation by Ion Mobility Mass Spectrometry
2019|Agilent Technologies|Applications
Application Note Biologics Examining the Structural Influence of Site-Specific Phosphorylation by Ion Mobility Mass Spectrometry Authors Rebecca S. Glaskin, Caroline S. Chu, and Dawn M. Stickle Agilent Technologies, Inc. Abstract This application note describes an automated workflow for the analysis…
Key words
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikccs, ccsfqseeqqqtedelqdk, fqseeqqqtedelqdkcharge, chargephosphorylation, phosphorylationnavpitptlnreqlstseenskk, navpitptlnreqlstseenskkmass, masssequence, sequencepeptides, peptidesekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper, ntppsqhshpsiqhsperphosphopeptides
Automation of Phosphoenrichment using Magnetic Fe-NTA Beads and KingFisher™ Apex Magnetic Particle Processor
2021|Thermo Fisher Scientific|Posters
Automation of Phosphoenrichment using Magnetic Fe-NTA Beads and KingFisher™ Apex Magnetic Particle Processor Maureen Mccoy*; Amarjeet Flora M.S.**; Leigh Foster B.S.**; Penny Jensen Ph.D.**; Bhavin Patel MD, M.S.**; Sergei Snovida Ph.D.**; Ryan Bomgarden Ph.D.** *University of Illinois Urbana Champaign **Thermo…
Key words
phosphopeptide, phosphopeptidekingfisher, kingfisherthermo, thermophosphoenrichment, phosphoenrichmentspecificity, specificityphosphopeptides, phosphopeptidescompetitor, competitormagnetic, magnetickingfishertm, kingfishertmapex, apexnta, ntabeads, beadsrinse, rinsesmoac, smoacaverage