Pre-clinical estimation of cetuximab using nano-surface and molecular orientation limited (nSMOL) proteolysis and LC-MS/MS
Posters | | ShimadzuInstrumentation
Monoclonal antibodies are increasingly used for cancer therapy and require accurate quantification in pharmacokinetic studies.
Traditional ligand binding assays, such as ELISA, face cross-reactivity and interference issues, whereas LC-MS/MS methods offer molecular specificity.
nSMOL proteolysis enhances selectivity and reduces background by targeting the Fab region, supporting robust bioanalysis.
The study aimed to develop and validate a sensitive LC-MS/MS assay for cetuximab in rat plasma using the nSMOL approach.
Key goals included assessing linearity, accuracy, precision, and practical robustness across a 0.29–150 µg/mL concentration range.
Brief overview of sample preparation:
Linearity and calibration:
The combination of nSMOL proteolysis and triple quadrupole LC-MS/MS delivers a robust, sensitive, and selective assay for cetuximab quantitation in rat plasma.
This workflow addresses key limitations of conventional assays and supports preclinical pharmacokinetic investigations with high accuracy and reproducibility.
[1] Iwamoto N et al., Analytical Methods 7(21):9177–9183 (2015).
[2] Iwamoto N et al., Analyst 139(3):576–580 (2014).
[3] Iwamoto N et al., Drug Metabolism and Pharmacokinetics 31(1):46–50 (2016).
[4] Iwamoto N et al., Bioanalysis 8(10):1009–1020 (2016).
LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerShimadzu
Summary
Preclinical Quantification of Cetuximab via nSMOL Proteolysis and LC-MS/MS
Importance of the Topic
Monoclonal antibodies are increasingly used for cancer therapy and require accurate quantification in pharmacokinetic studies.
Traditional ligand binding assays, such as ELISA, face cross-reactivity and interference issues, whereas LC-MS/MS methods offer molecular specificity.
nSMOL proteolysis enhances selectivity and reduces background by targeting the Fab region, supporting robust bioanalysis.
Objectives and Study Overview
The study aimed to develop and validate a sensitive LC-MS/MS assay for cetuximab in rat plasma using the nSMOL approach.
Key goals included assessing linearity, accuracy, precision, and practical robustness across a 0.29–150 µg/mL concentration range.
Methodology and Instrumentation
Brief overview of sample preparation:
- Immobilize cetuximab-spiked plasma on immunoglobulin collection resin.
- Perform selective Fab proteolysis using trypsin-coated FG beads (nSMOL protocol).
- Wash and collect signature peptides via centrifugation.
- Analyze peptides by UHPLC-ESI-MS/MS under gradient elution.
- UHPLC: Nexera X2 with Shim-pack GISS C18 column, gradient of 0.1% formic acid in water/acetonitrile.
- Mass spectrometer: LCMS-8060 triple quadrupole with heated ESI probe.
- MRM transitions: GPSVFPLAPSSK (594>699) for cetuximab, P14R (512>292) for internal standard.
Main Results and Discussion
Linearity and calibration:
- Concentration range: 0.29–150 µg/mL in Wistar rat plasma.
- Correlation coefficient (R²): 0.9983, demonstrating excellent linearity.
- Quality control samples (low, medium, high) showed 84–120% accuracy.
- Reproducibility was maintained across replicate analyses.
- Blank plasma showed no interfering peaks at target m/z values.
- Heated ESI improved desolvation and signal intensity for large peptide ions.
Benefits and Practical Applications
- nSMOL reduces sample complexity and matrix effects, speeding method development.
- High specificity for Fab-derived peptides enables reliable quantification in complex matrices.
- Applicable to preclinical pharmacokinetic and biosimilar comparability studies.
Future Trends and Applications
- Extension to other monoclonal antibodies and multi-analyte panels.
- Automation of nSMOL workflow for high-throughput bioanalysis.
- Integration with emerging mass spectrometry platforms and data analytics.
- Application in clinical pharmacokinetics, immunogenicity assessment, and biosimilar evaluation.
Conclusion
The combination of nSMOL proteolysis and triple quadrupole LC-MS/MS delivers a robust, sensitive, and selective assay for cetuximab quantitation in rat plasma.
This workflow addresses key limitations of conventional assays and supports preclinical pharmacokinetic investigations with high accuracy and reproducibility.
Reference
[1] Iwamoto N et al., Analytical Methods 7(21):9177–9183 (2015).
[2] Iwamoto N et al., Analyst 139(3):576–580 (2014).
[3] Iwamoto N et al., Drug Metabolism and Pharmacokinetics 31(1):46–50 (2016).
[4] Iwamoto N et al., Bioanalysis 8(10):1009–1020 (2016).
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Bioanalytical assessment of Cetuximab in Wistar rat plasma using nSMOL and LCMS-8060
2011|Shimadzu|Applications
LC/MS nSMOL and Liquid Chromatography Mass Spectrometry LC-31-ADI-54 Bioanalytical assessment of Cetuximab in Wistar rat plasma using nSMOL and LCMS-8060 ■ Introduction Cetuximab is a human monoclonal antibody (mAb) for the treatment of metastatic colorectal carcinoma, head and neck cancer.…
Key words
nsmol, nsmolcetuximab, cetuximabfab, fabrat, ratproteolysis, proteolysismab, mabwistar, wistarantibody, antibodyplasma, plasmansmoltm, nsmoltmbioanalysis, bioanalysisselective, selectivebioanalytical, bioanalyticalnano, nanosingular
LCMS Bioanalysis of Antibody Drugs Using Fab-selective Proteolysis “nSMOL Method” — Selection of Signature Peptide —
2017|Shimadzu|Applications
C146-E340 LCMS Bioanalysis of Antibody Drugs Using Fab-selective Proteolysis “nSMOL Method” Technical Report — Selection of Signature Peptide — Noriko Iwamoto1, Takashi Shimada1 A b s tra c t: nSMOL (nano-surface and molecular-orientation limited proteolysis) is Shimadzu's completely new, proprietary,…
Key words
ctx, ctxbrx, brxifx, ifxrtx, rtxnsmol, nsmolfab, fabsignature, signatureifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls, ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslspellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkp, pellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflysklt, ppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytl, reeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlvdksrwqqgnvfscsvmhealhnhytqkslslspgk, vdksrwqqgnvfscsvmhealhnhytqkslslspgkantibody, antibodyimmunoglobulin, immunoglobulintrypsin
LCMS Bioanalysis of Antibody Drugs Using Fab- Selective Proteolysis nSMOL - Part 4 - Multiplex Analysis -
2017|Shimadzu|Applications
LAAN-A-LM-E119A Application News No. C148A nSMOLTM Antibody BA Kit LCMS Bioanalysis of Antibody Drugs Using FabSelective Proteolysis nSMOL - Part 4 - Multiplex Analysis - nSMOLTM Antibody BA Kit Features nSMOL is Shimadzu's completely new and breakthrough technology that…
Key words
multiplex, multiplexantibody, antibodystructure, structurensmol, nsmolconfirmation, confirmationquantitation, quantitationbrentuximab, brentuximabcetuximab, cetuximabrituximab, rituximabdrugs, drugsmrm, mrmnsmoltm, nsmoltmvedotin, vedotinanalysis, analysisplasma
LCMS Bioanalysis of Antibody Drugs Using Fab- Selective Proteolysis nSMOL - Part 4 - Multiplex Analysis -
2017|Shimadzu|Applications
LAAN-A-LM-E119A Application News No. C148A nSMOLTM Antibody BA Kit LCMS Bioanalysis of Antibody Drugs Using FabSelective Proteolysis nSMOL - Part 4 - Multiplex Analysis - nSMOLTM Antibody BA Kit Features nSMOL is Shimadzu's completely new and breakthrough technology that…
Key words
multiplex, multiplexantibody, antibodystructure, structureconfirmation, confirmationnsmol, nsmolquantitation, quantitationbrentuximab, brentuximabcetuximab, cetuximabrituximab, rituximabdrugs, drugsmrm, mrmnsmoltm, nsmoltmvedotin, vedotinanalysis, analysisplasma