MRM Quantification of Chitotriosidase in Human Plasma
Applications | 2009 | WatersInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerWaters
Key wordschitotriosidase, activity, mrm, experiments, gaucher, were, based, patients, peptides, enzyme, nanoacquity, applied, assay, patient, biochemical, chitotriosadase, dlddfagfscnqgrypliqtlrqelslpylpsgtpelevpkpgqpsepehgpspgqdtfc, layyevcswkgatkqriqdqkvpyifrdnqwvgfddvesfktkvsylkqkglggamvwal, lnvdaavqqwlqkgtpasklilgmptygrsftlasssdtrvgapatgsgtpgpftkeggm, mtnhqlsttewndetlyqefnglkkmnpklktllaiggwnfgtqkftdmvatannrqtfv, mvrsvawagfmvllmipwgsaaklvcyftnwaqyrqgearflpkdldpslcthliyafag, nsairflrkysfdgldldweypgsqgspavdkerfttlvqdlanafqqeaqtsgkerlll, qgkadglypnprerssfyscaagrlfqqscptglvfsnsckcctwn, saavpagqtyvdagyevdkiaqnldfvnlmaydfhgswekvtghnsplykrqeesgaaas, plasma, interest, intial, disease, supple, quantification, concentration, biochemically, absolute, compared, symptomatic, macrophages, methods, nanoease, deter, develop, lusions, accounting, enta, peptide, exemplified, proteins, measurements, uplc, genomic, two
Similar PDF
IdentIfIcatIon and QuantIfIcatIon of dIagnostIcs Markers and Pathway analysIs for gaucher dIsease by Means of lc/ms
2007|Waters|Applications
[application note] Id ent ific at ion and Quant ific at ion of Diagnost ic s Ma rk e rs and Pat h way Ana lysis fo r Gauc h e r Dis eas e by M eans of LC…
Key words
serum, serumdepleted, depletedchitotriosidase, chitotriosidasetreatment, treatmentgaucher, gaucherundepleted, undepletedclustering, clusteringpeptide, peptideabsolute, absolutepre, preprotein, proteinintensity, intensityific, ificabnormalities, abnormalitiesdisease
PEPTIDE AND PROTEIN BIOANALYSIS
2016|Waters|Guides
[ APPLICATION NOTEBOOK ] PEPTIDE AND PROTEIN BIOANALYSIS [ OUR SCIENTISTS ] Yun Alelyunas, PhD Before coming to Waters in 2012, Yun Alelyunas was a principal scientist and team leader at AstraZeneca for 20 years where she was involved in…
Key words
ionkey, ionkeypeptide, peptideplasma, plasmaquantification, quantificationhuman, humanxevo, xevoarea, areainsulin, insulinuplc, uplcprotein, proteinpeptides, peptidesmrm, mrmproteinworks, proteinworksantibody, antibodyusing
MRM Analysis of a Parkinson’s Disease Protein Signature
2013|Waters|Applications
MRM Analysis of a Parkinson’s Disease Protein Signature Tiziana Alberio,1,2 Kelly McMahon,3 Manuela Cuccurullo,4 Lee A Gethings,3 Craig Lawless,5 Maurizio Zibetti,6 Johannes PC Vissers,3 Leonardo Lopiano,6 Mauro Fasano1,2 1 Division of Biomedical Sciences, Department of Theoretical and Applied Sciences, University…
Key words
parkinson, parkinsonmrm, mrmdisease, diseasepeptide, peptidesignature, signatureprotein, proteintransitions, transitionssubjects, subjectsmprophet, mprophetwere, weremononuclear, mononuclearlymphocytes, lymphocytestargetlynx, targetlynxnanoscale, nanoscaleclassification
Targeted proteomic analysis of human plasma on a discovery scale
2021|Thermo Fisher Scientific|Applications
APPLICATION NOTE 65957 Targeted proteomic analysis of human plasma on a discovery scale PQ500 and TSQ Altis triple quadrupole mass spectrometer Introduction As plasma interacts with every organ in the body it’s protein composition can reflect the physiological state of…
Key words
protein, proteinimmunoglobulin, immunoglobulinfmol, fmolfactor, factorapolipoprotein, apolipoproteinapo, apolod, lodglobin, globingrowth, growthreceptor, receptorcoagulation, coagulationalpha, alphahemoglobin, hemoglobinsubunit, subunitheavy