LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Advancing Host Cell Protein Analyses Through the Combined Use of Microscale 2D RP/RP with CSH C18 and Ion Mobility Enabled MS Detection

Applications | 2014 | WatersInstrumentation
Consumables, Ion Mobility, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, LC columns, 2D-LC
Industries
Proteomics
Manufacturer
Waters
Key words
Downloadable PDF for viewing
 

Similar PDF

Toggle
Assay for Identification and Quantification of Host Cell Protein Impurities in High-Purity Monoclonal Antibodies Down to 1 ppm: An Inter-Laboratory Study Catalin E. Doneanu, Malcolm Anderson, Brad J. Williams, Matthew A. Lauber, Asish Chakraborty, and Weibin Chen Waters Corporation, Milford,…
Key words
hcp, hcphcps, hcpsmobility, mobilitypeptide, peptideenergy, energyspectrum, spectrumseparation, separationhdms, hdmsprecursor, precursorfragmentation, fragmentationconfirmatory, confirmatorymobilogram, mobilogramplgs, plgsprotein, proteincell
Evaluating 2D-RP/RP Fractionation Capabilities of the ACQUITY UPLC M-Class System with 300-µm I.D. Configuration Catalin E. Doneanu, Asish Chakraborty, Patricia Young and Weibin Chen Waters Corporation, Milford, MA, USA A P P L I C AT I O N B…
Key words
enl, enlpeptide, peptideuplc, uplcpho, phoacquity, acquityadh, adhhcps, hcpsgnptvevelttek, gnptvevelttekvnqigtlsesik, vnqigtlsesiknvndviapafvk, nvndviapafvkclass, classcell, cellmin, mindimer, dimerbsa
IDENTIFICATION AND QUANTIFICATION OF HOST CELL PROTEIN IMPURITIES IN HIGH PURITY MONOCLONAL ANTIBODIES DOWN TO 1 PPM: AN INTER-LABORATORY STUDY Catalin Doneanu1, Scott J. Berger1, Malcolm Anderson2, Brad Williams3, Matt Lauber1, Asish Chakraborty1 and Weibin Chen1 1 Waters Corporation, Milford,…
Key words
hcps, hcpshcp, hcpmab, mabmse, mseims, imsiaifgatgr, iaifgatgrlchdmse, lchdmsemaeerqdalr, maeerqdalrmobility, mobilitylcmse, lcmsenist, nistreference, referencepeptide, peptideremicade, remicadehdmse
An Introduction to the Capabilities of Microscale 2D-RP/RP Peptide Chromatography with an ACQUITY UPLC M-Class System Matthew A Lauber, Stephan M Koza, and Kenneth J Fountain G OA L 2D-RP/RP with the ACQUITY M-Class System To demonstrate the performance capabilities…
Key words
separations, separationscapacity, capacitypeptide, peptidemeans, meansorgano, organopeak, peakmonitored, monitoredacquity, acquityavddflisldgtank, avddflisldgtankvipaadlseqistagteasgtgnmk, vipaadlseqistagteasgtgnmkwlvlcnpglaeiiaer, wlvlcnpglaeiiaerbeh, behanellinvk, anellinvkgnptvevelttek, gnptvevelttekiataiek
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike