Advancing Host Cell Protein Analyses Through the Combined Use of Microscale 2D RP/RP with CSH C18 and Ion Mobility Enabled MS Detection
Applications | 2014 | WatersInstrumentation
The identification and quantitation of host cell protein (HCP) impurities in biotherapeutics is critical to product safety and regulatory compliance. High peak capacity separations and sensitive MS detection are essential to resolve trace-level protein contaminants within complex peptide mixtures.
This study evaluates a microscale two-dimensional reversed-phase/reversed-phase (2D-RP/RP) LC-MS workflow combining charged surface hybrid C18 (CSH C18) columns and ion mobility-enabled HDMSE detection. The goal is to improve loadability, resolution, and detection limits for HCP analysis at single-digit ppm levels.
A monoclonal antibody (IgG1K) digest spiked with a calibrant tryptic digest was separated using a 10-step 2D-RP/RP scheme:
Key instrumentation:
The CSH C18 2nd dimension column maintained peak capacity at sample loads five times higher than conventional silica C18, yielding sharper peaks and reduced co-elution. Compared to a 0.2 mg digest with silica C18 and MSE detection (5 HCPs identified), the 1.0 mg digest with CSH C18 and HDMSE enabled detection of 14 HCPs. Hi3 quantitation estimated seven HCPs below 20 ppm, with the lowest at 2 ppm and 6 ppm, demonstrating enhanced dynamic range and sensitivity.
Advances may include integration of ultra-high-pressure systems (>15K psi), novel stationary phases for enhanced selectivity, and AI-driven data analysis pipelines. Expansion to other low-abundance biomarker studies and streamlined automated workflows is anticipated.
The combined use of microscale 2D-RP/RP with CSH C18 and HDMSE detection significantly advances HCP analysis by improving peak capacity at high loads and achieving single-digit ppm detection. This approach offers a robust platform for comprehensive impurity profiling in biotherapeutics.
Consumables, Ion Mobility, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, LC columns, 2D-LC
IndustriesProteomics
ManufacturerWaters
Summary
Significance of the Topic
The identification and quantitation of host cell protein (HCP) impurities in biotherapeutics is critical to product safety and regulatory compliance. High peak capacity separations and sensitive MS detection are essential to resolve trace-level protein contaminants within complex peptide mixtures.
Objectives and Study Overview
This study evaluates a microscale two-dimensional reversed-phase/reversed-phase (2D-RP/RP) LC-MS workflow combining charged surface hybrid C18 (CSH C18) columns and ion mobility-enabled HDMSE detection. The goal is to improve loadability, resolution, and detection limits for HCP analysis at single-digit ppm levels.
Methodology and Instrumentation
A monoclonal antibody (IgG1K) digest spiked with a calibrant tryptic digest was separated using a 10-step 2D-RP/RP scheme:
- First dimension: high-pH RP on XBridge Peptide BEH C18 trap and analytical column.
- Second dimension: low-pH RP on CSH C18 analytical column or conventional silica C18 for comparison.
- Ion mobility-enabled MS detection (HDMSE) on a SYNAPT G2-S system.
Key instrumentation:
- ACQUITY UPLC M-Class System
- ACQUITY UPLC M-Class CSH™ C18 Column (300 µm × 150 mm, 1.7 µm)
- ACQUITY UPLC M-Class Symmetry® C18 2D HCP Trap Column (300 µm × 25 mm, 5 µm)
- XBridge Peptide BEH C18 Column (1.0 × 50 mm, 5 µm)
- SYNAPT G2-S Mass Spectrometer with HDMSE capability
Main Results and Discussion
The CSH C18 2nd dimension column maintained peak capacity at sample loads five times higher than conventional silica C18, yielding sharper peaks and reduced co-elution. Compared to a 0.2 mg digest with silica C18 and MSE detection (5 HCPs identified), the 1.0 mg digest with CSH C18 and HDMSE enabled detection of 14 HCPs. Hi3 quantitation estimated seven HCPs below 20 ppm, with the lowest at 2 ppm and 6 ppm, demonstrating enhanced dynamic range and sensitivity.
Benefits and Practical Applications
- Improved chromatographic loadability and resolution at high sample loads.
- Reduced spectral crowding and improved peptide fragment assignment via ion mobility.
- Lower detection limits for HCP impurities, enabling more comprehensive safety profiling.
- Robust, user-friendly high-pressure microscale LC-MS workflow applicable to QA/QC and proteomics.
Future Trends and Potential Applications
Advances may include integration of ultra-high-pressure systems (>15K psi), novel stationary phases for enhanced selectivity, and AI-driven data analysis pipelines. Expansion to other low-abundance biomarker studies and streamlined automated workflows is anticipated.
Conclusion
The combined use of microscale 2D-RP/RP with CSH C18 and HDMSE detection significantly advances HCP analysis by improving peak capacity at high loads and achieving single-digit ppm detection. This approach offers a robust platform for comprehensive impurity profiling in biotherapeutics.
References
- Doneanu et al., MAbs 2012, 4(1), 24–44.
- Schenauer et al., Anal Biochem 2012, 428(2), 150–157.
- Schenauer et al., Biotechnol Prog 2013, 29(4), 951–957.
- Lauber et al., Anal Chem 2013, 85(14), 6936–6944.
- Gilar et al., J Sep Sci 2005, 28(14), 1694–1703.
- Lauber et al., Waters Application Note 720004934EN, 2014.
- Lauber et al., Waters Application Note 720005047EN, 2014.
- Thompson & Stapels, Bioanalysis Zone Webcast, 2012.
- Silva et al., Mol Cell Proteomics 2006, 5(4), 589–607.
- Silva et al., Mol Cell Proteomics 2006, 5(1), 144–156.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Assay for Identification and Quantification of Host Cell Protein Impurities in High-Purity Monoclonal Antibodies Down to 1 ppm: An Inter-Laboratory Study
2015|Waters|Applications
Assay for Identification and Quantification of Host Cell Protein Impurities in High-Purity Monoclonal Antibodies Down to 1 ppm: An Inter-Laboratory Study Catalin E. Doneanu, Malcolm Anderson, Brad J. Williams, Matthew A. Lauber, Asish Chakraborty, and Weibin Chen Waters Corporation, Milford,…
Key words
hcp, hcphcps, hcpsmobility, mobilitypeptide, peptideenergy, energyspectrum, spectrumseparation, separationhdms, hdmsprecursor, precursorfragmentation, fragmentationconfirmatory, confirmatorymobilogram, mobilogramplgs, plgsprotein, proteinbiotherapeutic
Evaluating 2D-RP/RP Fractionation Capabilities of the ACQUITY UPLC M-Class System with 300-μm I.D. Configuration
2015|Waters|Applications
Evaluating 2D-RP/RP Fractionation Capabilities of the ACQUITY UPLC M-Class System with 300-µm I.D. Configuration Catalin E. Doneanu, Asish Chakraborty, Patricia Young and Weibin Chen Waters Corporation, Milford, MA, USA A P P L I C AT I O N B…
Key words
enl, enlpeptide, peptideuplc, uplcacquity, acquitypho, phoadh, adhhcps, hcpsgnptvevelttek, gnptvevelttekvnqigtlsesik, vnqigtlsesiknvndviapafvk, nvndviapafvkclass, classcell, cellmin, minbsa, bsadimer
IDENTIFICATION AND QUANTIFICATION OF HOST CELL PROTEIN IMPURITIES IN HIGH PURITY MONOCLONAL ANTIBODIES DOWN TO 1 PPM: AN INTER-LABORATORY STUDY
2016|Waters|Posters
IDENTIFICATION AND QUANTIFICATION OF HOST CELL PROTEIN IMPURITIES IN HIGH PURITY MONOCLONAL ANTIBODIES DOWN TO 1 PPM: AN INTER-LABORATORY STUDY Catalin Doneanu1, Scott J. Berger1, Malcolm Anderson2, Brad Williams3, Matt Lauber1, Asish Chakraborty1 and Weibin Chen1 1 Waters Corporation, Milford,…
Key words
hcps, hcpshcp, hcpmab, mabmse, mseims, imsiaifgatgr, iaifgatgrlchdmse, lchdmsemaeerqdalr, maeerqdalrmobility, mobilitylcmse, lcmsenist, nistreference, referenceremicade, remicadepeptide, peptidehdmse
An Introduction to the Capabilities of Microscale 2D-RP/RP Peptide Chromatography with an ACQUITY UPLC M-Class System
2014|Waters|Applications
An Introduction to the Capabilities of Microscale 2D-RP/RP Peptide Chromatography with an ACQUITY UPLC M-Class System Matthew A Lauber, Stephan M Koza, and Kenneth J Fountain G OA L 2D-RP/RP with the ACQUITY M-Class System To demonstrate the performance capabilities…
Key words
separations, separationscapacity, capacitypeptide, peptidepeak, peakmeans, meansorgano, organomonitored, monitoredacquity, acquitybeh, behavddflisldgtank, avddflisldgtankvipaadlseqistagteasgtgnmk, vipaadlseqistagteasgtgnmkwlvlcnpglaeiiaer, wlvlcnpglaeiiaeranellinvk, anellinvkgnptvevelttek, gnptvevelttekiataiek