Easy, fast and reproducible analysis of host cell protein (HCP) in monoclonal antibody preparations
Applications | 2019 | Thermo Fisher ScientificInstrumentation
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
IndustriesPharma & Biopharma
ManufacturerThermo Fisher Scientific
Key wordshcp, peptide, hcps, mapping, host, bead, smart, kingfisher, lane, setting, cell, digest, mab, charge, analysis, protein, cva, thermo, mass, chromatographic, variant, cricetulus, hydrolysis, buffer, drug, protease, width, magnetic, deamidation, monoclonal, product, duo, digestion, heavy, beads, scientific, prep, derived, our, prime, workflow, maximum, resolution, using, exactive, adalimumab, respect, peak, investigate, high
Similar PDF
LC-MS-based host cell protein (HCP) identification and monitoring during biopharmaceutical downstream process development
2021|Thermo Fisher Scientific|Applications
APPLICATION NOTE 74162 LC-MS-based host cell protein (HCP) identification and monitoring during biopharmaceutical downstream process development Authors: Xiaoxi Zhang1, Zijuan Chen2, Bingnan Li2, Jennifer Sutton3, Min Du4 Thermo Fisher Scientific 1 Shanghai, China; 2 Bioprocess Design Center, Shanghai, China; 3…
Key words
hcp, hcppool, poolhcps, hcpscex, cexabundance, abundancerelative, relativeaex, aexprotein, proteinpeptide, peptidedownstream, downstreammab, mabphospholipase, phospholipaseprocess, processppm, ppmhost
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestduo, duoprime, primemagnetic, magneticadalimumab
Peptide mapping of challenging monoclonal antibodies
2020|Thermo Fisher Scientific|Applications
CUSTOMER APPLICATION NOTE 73826 Peptide mapping of challenging monoclonal antibodies Authors: Dan Bach Kristensen1, Trine Meiborg Sloth1, Martin Ørgaard1, Krisztina Radi2 Symphogen, Ballerup, Denmark Thermo Fisher Scientific, Hemel Hempstead, UK 1 2 Keywords: Peptide mapping, monoclonal antibody, mAb, post-translational modifications,…
Key words
pepsin, pepsintrypsin, trypsinpeptides, peptidesdigest, digestpeptide, peptidesmart, smartlane, lanemapping, mappinghydrophobic, hydrophobicdigestion, digestionisolation, isolationcdr, cdrmicroscans, microscansregions, regionschallenging
Confident LC-MS Identification of Low ppm Host Cell Proteins (HCPs) in Biotherapeutic Monoclonal Antibodies
2020|Thermo Fisher Scientific|Posters
Confident LC-MS Identification of Low ppm Host Cell Proteins (HCPs) in Biotherapeutic Monoclonal Antibodies Amy J Claydon1, Phil Widdowson1, Andrew Williamson2, and Min Du3, Thermo Fisher Scientific, 1Runcorn, UK, 2Hemel Hempstead, UK, 3Cambridge, MA, USA Label-free quantification of NISTmAb HCPs…
Key words
hcps, hcpshcp, hcpppm, ppmnistmab, nistmabdynamic, dynamicintrasample, intrasampleclathrin, clathrinhydratase, hydrataseidentifications, identificationsper, pergranulins, granulinstransketolase, transketolasebisphosphate, bisphosphatedigest, digestmeasured