Oligonucleotide characterization for quality control and increased productivity by single quadrupole mass spectrometer with extended mass range
Applications | 2018 | Thermo Fisher ScientificInstrumentation
Quality control of synthetic oligonucleotides is critical in research and manufacturing to ensure sequence integrity and purity. UV detection at 260 nm efficiently quantifies overall yield but cannot distinguish closely eluting impurities or confirm exact masses. Integrating mass spectrometry into routine QC workflows provides unambiguous mass confirmation and low-level impurity identification without extensive method redevelopment.
This study demonstrates how a Thermo Scientific ISQ EM single quadrupole mass spectrometer can be incorporated into an existing UV-based QC method for DNA oligomers of 29–40 bases. The objective is to enhance productivity by enabling rapid mass verification, impurity profiling, and rough quantification in parallel with standard UV analysis.
Reversed-phase ion pairing UHPLC was performed on a short polymeric DNAPac RP column (2.1 × 10 mm, 4 μm) using a TEA/HFIP aqueous mobile phase and methanol gradient. A 1 μL injection volume and fast gradient (0.5 mL/min) enabled all oligomers to elute within 1.4 minutes, followed by an extended equilibration period. UV detection at 260 nm provided concentration calibration from 0.05 to 50 μM. Mass spectrometry was conducted in negative mode with full scans over m/z 600–2000 and SIM scans for the predominant -9 charge state. Calibration curves were built from extracted ion chromatograms and SIM peak areas.
As oligonucleotide therapies and diagnostics advance, demand for high-throughput, reliable QC will grow. Future developments may include integration of high-resolution MS for definitive impurity identification, automation of data analysis workflows, new ion pairing reagents to enhance robustness, and expanded column chemistries to improve separation of closely related species.
Incorporating a single quadrupole MS into a UV-based QC workflow for synthetic oligonucleotides delivers rapid, accurate mass confirmation and impurity profiling without sacrificing throughput or ease of use. The extended mass range, orthogonal ion source design, and intuitive CDS interface facilitate routine adoption by chromatographers, ultimately enhancing confidence and efficiency in oligonucleotide quality assessment.
LC/MS, LC/SQ
IndustriesPharma & Biopharma
ManufacturerThermo Fisher Scientific
Summary
Importance of the Topic
Quality control of synthetic oligonucleotides is critical in research and manufacturing to ensure sequence integrity and purity. UV detection at 260 nm efficiently quantifies overall yield but cannot distinguish closely eluting impurities or confirm exact masses. Integrating mass spectrometry into routine QC workflows provides unambiguous mass confirmation and low-level impurity identification without extensive method redevelopment.
Goals and Study Overview
This study demonstrates how a Thermo Scientific ISQ EM single quadrupole mass spectrometer can be incorporated into an existing UV-based QC method for DNA oligomers of 29–40 bases. The objective is to enhance productivity by enabling rapid mass verification, impurity profiling, and rough quantification in parallel with standard UV analysis.
Methodology
Reversed-phase ion pairing UHPLC was performed on a short polymeric DNAPac RP column (2.1 × 10 mm, 4 μm) using a TEA/HFIP aqueous mobile phase and methanol gradient. A 1 μL injection volume and fast gradient (0.5 mL/min) enabled all oligomers to elute within 1.4 minutes, followed by an extended equilibration period. UV detection at 260 nm provided concentration calibration from 0.05 to 50 μM. Mass spectrometry was conducted in negative mode with full scans over m/z 600–2000 and SIM scans for the predominant -9 charge state. Calibration curves were built from extracted ion chromatograms and SIM peak areas.
Instrumentation
- Thermo Scientific Vanquish Flex UHPLC system with Binary Pump F, Split Sampler FT, Column Compartment H, and Variable Wavelength Detector F
- ISQ EM single quadrupole mass spectrometer (m/z 10–2000) with orthogonal electrospray ionization
- Chromeleon 7.2 Chromatography Data System for instrument control, method setup and data processing
Main Results and Discussion
- UV calibration of a 37mer oligomer yielded linearity (R² = 0.9996) from 0.05 to 50 μM.
- MS-based calibration using the -9 charge state XIC achieved R² up to 0.966 over 0.5–50 μM, with y-intercepts near zero.
- Mass confirmation across eight charge states exhibited accuracy within ±0.1 Da and RSD ≤0.02% for most states.
- Impurity profiling for the 37mer identified HFIP adducts (~39%), potassium adducts (~14%), depurination products (~8.5%), N-1 aborted sequences (~6%), and trace modifications (2-cyanoethyl, isobutyryl, chloral derivatives at <3%).
- Extending the column equilibration time from 1 to 4.5 minutes improved MS peak area reproducibility (RSD from 15.4% to 8.1%).
Benefits and Practical Applications
- Seamless extension of UV QC methods to include MS adds mass confirmation and impurity identity without new chromatography method development.
- Rapid detection of low-level synthesis by-products and adducts that coelute with the main product.
- User-friendly LC-MS interface lowers the barrier for chromatographers to adopt mass spectrometry in routine QC.
- Robust operation demonstrated over 100 injections with minimal source maintenance despite persistent ion pairing reagents.
Future Trends and Opportunities
As oligonucleotide therapies and diagnostics advance, demand for high-throughput, reliable QC will grow. Future developments may include integration of high-resolution MS for definitive impurity identification, automation of data analysis workflows, new ion pairing reagents to enhance robustness, and expanded column chemistries to improve separation of closely related species.
Conclusion
Incorporating a single quadrupole MS into a UV-based QC workflow for synthetic oligonucleotides delivers rapid, accurate mass confirmation and impurity profiling without sacrificing throughput or ease of use. The extended mass range, orthogonal ion source design, and intuitive CDS interface facilitate routine adoption by chromatographers, ultimately enhancing confidence and efficiency in oligonucleotide quality assessment.
Reference
- Apffel A, Chakel JA, Fischer S, Lichtenwalter K, Hancock WS. Analysis of oligonucleotides by HPLC-electrospray ionization mass spectrometry. Anal. Chem. 1997;69(8):1320–1325.
- Nikcevic I, Wyrzykiewicz TK, Limbach PA. Detecting low-level synthesis impurities in modified phosphorothioate oligonucleotides using liquid chromatography—high resolution mass spectrometry. Int. J. Mass Spectrom. 2011;304:98–104.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Thermo Scientific ISQ EC and ISQ EM single quadrupole mass spectrometers
2018|Thermo Fisher Scientific|Brochures and specifications
Join the mass movement towards mass spectrometry Thermo Scientific ISQ EC and ISQ EM single quadrupole mass spectrometers Embrace the power of mass spectrometry Achieving a comprehensive understanding of the samples you analyze is always a challenge. At Thermo Fisher…
Key words
isq, isqmass, masshesi, hesiapci, apcispectrometers, spectrometersthermo, thermoscientific, scientificspectrometer, spectrometersim, simtenofovir, tenofoviryour, yourchromeleon, chromeleonimpurity, impurityroutine, routinesensitivity
High-throughput analysis of oligonucleotides using a single quadrupole mass spectrometer for quality control
2022|Thermo Fisher Scientific|Applications
Application note | 000457 Mass Spectrometry High-throughput analysis of oligonucleotides using a single quadrupole mass spectrometer for quality control Authors Application benefits Dennis Köhler, Mauro De Pra; This work provides a simple and comprehensive quality control workflow from Thermo Fisher…
Key words
hfip, hfipintensity, intensityspectral, spectralmass, massvanquish, vanquishadduct, adductoligomer, oligomercharge, chargecounts, countstarget, targetisq, isqvaporizer, vaporizerhfiphfip, hfiphfipvariables, variablesoligonucleotides
Quality control of oligonucleotides with a single quadrupole mass spectrometer
2020|Thermo Fisher Scientific|Technical notes
TECHNICAL NOTE 73670 Quality control of oligonucleotides with a single quadrupole mass spectrometer Author: Stephan Meding Thermo Fisher Scientific, Germering, Germany Keywords: Single quadrupole mass spectrometer, ISQ EM, Vanquish Flex Binary, Chromeleon CDS, intact mass deconvolution Goal Show the benefit…
Key words
mass, massanalyte, analyteoligonucleotide, oligonucleotideisq, isqintensity, intensitycharge, chargecounts, countsdeprotonated, deprotonatedsource, sourcevanquish, vanquishpeak, peakconfirmation, confirmationdeconvolution, deconvolutionadduct, adductsettings
Quality Control of Synthetic Biomolecules Using Rapid Methods with Serial Coupling of UV and MS Detectors
2019|Thermo Fisher Scientific|Posters
Quality Control of Synthetic Biomolecules Using Rapid Methods with Serial Coupling of UV and MS Detectors Sylvia Grosse, Katherine Lovejoy, Martin Samonig, Mauro De Pra, Frank Steiner, Martin Ruehl, Thermo Fisher Scientific, Dornierstrasse 4, 82110 Germering, Germany ABSTRACT INSTRUMENTATION AND…
Key words
mass, massbiomolecules, biomoleculespeptide, peptidedna, dnapreheater, preheatersequence, sequenceobserved, observedaverage, averageisq, isqatgatattatgattaggagccgcgcagggag, atgatattatgattaggagccgcgcagggagcaggaaacagctatgacccgcgctcacctcgcctctg, caggaaacagctatgacccgcgctcacctcgcctctgllgdffrkskekigkefkrivqrikdflrnlvprtes, llgdffrkskekigkefkrivqrikdflrnlvprtesrkskekigkefkrivqrikdflrnlvprtes, rkskekigkefkrivqrikdflrnlvprtesskekigkefkrivqrikdflr, skekigkefkrivqrikdflrtgaaggaitgcactgaaaggcaggctaat