Quantitative targeted nano- and capillary- flow LC-MS peptide analysis using the Vanquish Neo UHPLC System coupled to a triple quadrupole mass spectrometer
Applications | 2021 | Thermo Fisher ScientificInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesProteomics
ManufacturerThermo Fisher Scientific
Key wordsfmol, counts, gilfvgsgvsggeegar, saagafgpelsr, zoom, area, nano, concentration, caplc, flow, pwhm, capillary, hela, peptide, wash, nanolc, prtc, ntration, enabled, flowflow, outer, thermo, scientific, ltileelr, elgqsgvdtylqtk, gisnegqnasik, peptides, time, pierce, fisher, min, vanquish, needle, neo, optima, carry, draw, abundance, moving, quantifiable, flowcontrol, combinedcontrol, weak, digest, sharper, relative, nsi, dipvpkpk, lsseapalfqfdlk, loading
Similar PDF
LC-MS: Ultra-robust micro-flow LC-MS/MS for targeted high-throughput peptide quantification using the Vanquish Neo UHPLC system
2021|Thermo Fisher Scientific|Technical notes
LC-MS Ultra-robust micro-flow LC-MS/MS for targeted high-throughput peptide quantification using the Vanquish Neo UHPLC system Authors in reduced electrospray ionization efficiency,2 which are difficult Stephan Meding, Alexander Boychenko, Runsheng Zheng, to compensate for by larger injection amounts due to the…
Key words
wash, washlsseapalfqfdlk, lsseapalfqfdlkelasglsfpvgfk, elasglsfpvgfkngfildgfpr, ngfildgfprsaagafgpelsr, saagafgpelsrgilfvgsgvsggeegar, gilfvgsgvsggeegarelgqsgvdtylqtk, elgqsgvdtylqtkltileelr, ltileelrsfanqplevvysk, sfanqplevvyskglilvggygtr, glilvggygtrssaapppppr, ssaappppprgisnegqnasik, gisnegqnasikigdyagik, igdyagikouter, outerneo
LC-MS: Vanquish Neo UHPLC system-to-system reproducibility ensures consistent and reliable results in nanoLC-MS proteomics
2021|Thermo Fisher Scientific|Technical notes
TECHNICAL NOTE LC-MS Vanquish Neo UHPLC system-to-system reproducibility ensures consistent and reliable results in nanoLC-MS proteomics Authors We investigated the intra- and inter-system variability for typical nanoLC-MS applications using the new Vanquish Neo UHPLC Christopher Pynn , Gisela Noack ,…
Key words
neo, neopeptide, peptidevanquish, vanquishwash, washprtc, prtcsystem, systemuhplc, uhplcnanolc, nanolcreproducibility, reproducibilitydigest, digestcytochrome, cytochromeprotein, proteinouter, outerretention, retentionscan
Long-term stability and reproducibility of nano-, capillary- and micro-flow LC-MS separations: the impact of hardware and separation column
2022|Thermo Fisher Scientific|Posters
Long-term stability and reproducibility of nano-, capillary- and micro-flow LC-MS separations: the impact of hardware and separation column Christopher Pynn1, Runsheng Zheng1; Tabiwang Arrey2; Amirmansoor Hakimi3; Alec Valenta1; Susanne Moyer1 1Thermo Fisher Scientific, Germering, Germany; 2Thermo Fisher Scientific, Bremen, Germany;…
Key words
neo, neonanolc, nanolcvanquish, vanquishthermo, thermouhplc, uhplcscientific, scientificsystem, systempepmap, pepmapreproducibility, reproducibilityconsistency, consistencyretention, retentionmicrolc, microlcterm, termproteomics, proteomicslong
A novel 75 cm column size gives increased resolution and better sequence coverage
2019|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21550 A novel 75 cm column size gives increased resolution and better sequence coverage Authors Goal Jon Ferguson*, Brian King, Mike Baynham Thermo Fisher Scientific, Runcorn, UK *Thermo Fisher Scientific, West Palm Beach, FL, USA To demonstrate the…
Key words
prtc, prtchela, helapeptide, peptidepeptides, peptidespwhh, pwhhgradient, gradientdigest, digestmass, massmin, minexactive, exactivepeak, peakuhplc, uhplcnanoflow, nanofloworbitrap, orbitrapaverage