LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Quantitative targeted nano- and capillary- flow LC-MS peptide analysis using the Vanquish Neo UHPLC System coupled to a triple quadrupole mass spectrometer

Applications | 2021 | Thermo Fisher ScientificInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
Industries
Proteomics
Manufacturer
Thermo Fisher Scientific

Summary

Importance of the Topic


The combination of low-flow liquid chromatography with mass spectrometry has been a cornerstone of proteomics for its high sensitivity when analyzing complex peptide mixtures. However, nano-flow methods often face challenges in robustness, throughput, and ease of use for large sample cohorts. Capillary-flow LC-MS offers a promising compromise, delivering high sensitivity alongside greater sample throughput and operational stability.

Study Objectives and Overview


This study evaluated the performance of a Thermo Scientific Vanquish Neo UHPLC system coupled to a TSQ Altis triple quadrupole mass spectrometer for quantitative targeted peptide analysis. By comparing nano-flow (0.3 µL/min) and capillary-flow (3.0 µL/min) workflows on the same hardware, the goal was to assess sensitivity, linearity, throughput, and long-term robustness in HeLa digest samples spiked with heavy-labeled PRTC peptides.

Methodology


Peptide standards (PRTC) were serially diluted in a HeLa protein digest matrix to concentrations from 0.01 to 100 fmol/µL. Nano-flow experiments used a 75 µm × 15 cm EASY-Spray PepMap Neo column with a 27 min gradient, while capillary-flow used a 150 µm × 15 cm column with a 12.4 min gradient. The TSQ Altis operated in selected reaction monitoring mode at 600 SRMs/s, ensuring >12 data points across each peak. Method performance was assessed for precision, accuracy, limit of quantitation (LoQ), peak shape, linearity, and carry-over, following FDA bioanalytical guidance.

Used Instrumentation


  • Thermo Scientific Vanquish Neo UHPLC system
  • Thermo Scientific TSQ Altis Triple Quadrupole Mass Spectrometer
  • Thermo Scientific EASY-Spray PepMap Neo columns (75 µm and 150 µm ID, 2 µm C18)
  • Thermo Scientific nanoViper fitting system
  • Chromeleon 7.2.10 MUd software for LC control

Key Results and Discussion


  • Analysis time was reduced by ~60% in capillary-flow (203 min for 10 runs) versus nano-flow (504 min).
  • Linearity for 15 PRTC peptides was excellent (average r = 0.9988 nano, 0.9993 capillary) over 0.01–100 fmol/µL.
  • Limits of quantitation were comparable: most peptides achieved 100 amol/µL quantitation in both modes.
  • Peak widths at half-height decreased by 75–80% in capillary-flow, enhancing signal-to-noise and resolution.
  • Long-term robustness: 200 injections over 75 h showed retention time RSD <0.28% and peak area RSD ~5.3%.
  • Carry-over remained low (<0.1%), with system contributions below 0.07%.

Benefits and Practical Applications


The capillary-flow LC-MS workflow on a unified Vanquish Neo platform combines high sensitivity with improved throughput and operational stability. It is particularly well suited for targeted peptide quantitation in clinical research, biomarker validation, QA/QC labs, and large cohort studies.

Future Trends and Applications


Advances may include further miniaturization of flow paths, integration of microfluidic devices, higher multiplexing in SRM/MRM assays, and automated sample handling to further boost throughput. Wider adoption of capillary-flow methods can bridge the gap between discovery proteomics and routine high-throughput screening.

Conclusion


The Vanquish Neo UHPLC system coupled to TSQ Altis delivers robust, reproducible, and highly sensitive targeted peptide quantitation at both nano- and capillary-flow rates. Capillary-flow methods achieve significant time savings without compromising analytical performance, providing a versatile solution for modern proteomic workflows.

References


  • Bian Y, Zheng R, Bayer FP et al. Robust, reproducible and quantitative analysis of thousands of proteomes by micro-flow LC–MS/MS. Nat Commun. 11:157 (2020).
  • Wilson SR, Vehus T, Berg HS, Lundanes E. Nano-LC in proteomics: recent advances and approaches. Bioanalysis. 7:1799–1815 (2015).
  • Meding S, Boychenko A. Capillary Flow LC-MS unites sensitivity and throughput. Chromatography Today. June 2016.
  • Boychenko A, Meding S, Decrop W et al. Capillary-flow LC-MS: combining high sensitivity, robustness, and throughput. Technical Note 72277 (2017).
  • Pitt JJ. Principles and applications of liquid chromatography-mass spectrometry in clinical biochemistry. Clin Biochem Rev. 30:19–34 (2009).
  • Hopfgartner G, Bean K, Henion J, Henry R. Ion spray MS detection for LC: concentration- or mass-flow-sensitive? J Chromatogr A. 647:51–61 (1993).
  • FDA. Bioanalytical Method Validation Guidance for Industry (2018).

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
LC-MS: Ultra-robust micro-flow LC-MS/MS for targeted high-throughput peptide quantification using the Vanquish Neo UHPLC system
LC-MS Ultra-robust micro-flow LC-MS/MS for targeted high-throughput peptide quantification using the Vanquish Neo UHPLC system Authors in reduced electrospray ionization efficiency,2 which are difficult Stephan Meding, Alexander Boychenko, Runsheng Zheng, to compensate for by larger injection amounts due to the…
Key words
wash, washlsseapalfqfdlk, lsseapalfqfdlkgilfvgsgvsggeegar, gilfvgsgvsggeegarsaagafgpelsr, saagafgpelsrelasglsfpvgfk, elasglsfpvgfkltileelr, ltileelrngfildgfpr, ngfildgfprelgqsgvdtylqtk, elgqsgvdtylqtkssaapppppr, ssaappppprglilvggygtr, glilvggygtrsfanqplevvysk, sfanqplevvyskgisnegqnasik, gisnegqnasikigdyagik, igdyagikouter, outerneo
LC-MS: Vanquish Neo UHPLC system-to-system reproducibility ensures consistent and reliable results in nanoLC-MS proteomics
TECHNICAL NOTE LC-MS Vanquish Neo UHPLC system-to-system reproducibility ensures consistent and reliable results in nanoLC-MS proteomics Authors We investigated the intra- and inter-system variability for typical nanoLC-MS applications using the new Vanquish Neo UHPLC Christopher Pynn , Gisela Noack ,…
Key words
neo, neopeptide, peptidewash, washvanquish, vanquishprtc, prtcsystem, systemuhplc, uhplcnanolc, nanolcreproducibility, reproducibilitydigest, digestcytochrome, cytochromeprotein, proteinouter, outerretention, retentionscan
Long-term stability and reproducibility of nano, capillary and micro-flow LC-MS separations
Poster # P-II-0440 Technological advancements in proteomics Long-term stability and reproducibility of nano, capillary and micro-flow LC-MS separations Christopher Pynn1, Runsheng Zheng1, Tabiwang Arrey1, Amirmansoor Hakimi2, Alec Valenta2, Martin Samonig3 Thermo Fisher Scientific, 1Germany; Thermo Fisher Scientific, 2USA; Thermo Fisher…
Key words
neo, neonanolc, nanolcterm, termreproducibility, reproducibilityvanquish, vanquishuhplc, uhplclong, longscientific, scientificfwhm, fwhmretention, retentionsystem, systemthermo, thermopeptide, peptiderobustness, robustnessmicro
The Thermo Scientific Capillary Flow LC MS Solutions
The Thermo Scientific Capillary Flow LC MS Solutions
|Thermo Fisher Scientific|Presentations
The Thermo Scientific Capillary-Flow LC-MS Solutions The world leader in serving science Content • Thermo Scientific™ LC-MS front-end UHPLC portfolio • Advantages of CapLC-MS and Fields of Application • The Thermo Scientific™ CapLC-MS solution • Application Examples • Available Additional…
Key words
caplc, caplcthermo, thermoscientific, scientificloading, loadingdigest, digestpeptides, peptidescytochrome, cytochromeflow, flowhypersil, hypersilretention, retentionrslcnano, rslcnanodirect, directsignal, signaltrap, trappre
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike