Migrating Methods from the ACQUITY™ UPLC™ “Classic” System to the ACQUITY Premier System (FL)
Applications | 2023 | WatersInstrumentation
HPLC
IndustriesManufacturerWaters
Key wordsacquity, classic, premier, migrating, uplc, system, methods, from, hps, maxpeak, lifecycle, tailing, legacy, aspartic, continually, expand, management, body, knowledge, mapping, drug, manufacturing, opportunities, terms, featuring, gradiant, peak, acid, safety, improve, feedforward, pluno, fixed, identifying, improvement, recovery, technology, loop, peptide, means, modernize, pharmaceutical, design, surface, recommended, bsm, ability, demonstrate, reduced, method
Similar PDF
Increasing Chromatographic Performance of Acidic Peptides in RPLC-MS-based Assays with ACQUITY PREMIER featuring MaxPeak HPS Technology
2020|Waters|Applications
Application Note Increasing Chromatographic Performance of Acidic Peptides in RPLC-MS-based Assays with ACQUITY PREMIER featuring MaxPeak HPS Technology Robert E. Birdsall, Jacob Kellet, Samantha Ippoliti, Nilini Ranbaduge, Henry Shion, Ying Qing Yu Waters Corporation Abstract Metal-ion mediated adsorption of analytes…
Key words
maxpeak, maxpeakhps, hpsacquity, acquitypremier, premierpeptide, peptidetechnology, technologytailing, tailingincreased, increasedcan, canacid, acidassay, assaychromatographic, chromatographicnative, nativerplc, rplcdrug
Method Scaling from ACQUITY™ Premier to Arc™ Premier System
2023|Waters|Technical notes
Application Note Method Scaling from ACQUITY™ Premier to Arc™ Premier System Xiangsha Du, Kellen DeLaney, Robert E. Birdsall, Tatyana Friedman Waters Corporation Abstract Instruments capable of delivering consistent and reproducible results are highly desirable for efficient development and manufacturing of…
Key words
premier, premierarc, arcscaling, scalingacquity, acquitysystem, systemmaxpeak, maxpeakmethod, methodfrom, fromcalculator, calculatorwaters, watersqda, qdacolumns, columnsusers, usersquanrecovery, quanrecoverysurfaces
PEGS: IMPROVING ANALYSIS OF QUALITY INDICATING ATTRIBUTES FOR BETTER LIFECYCLE MANAGEMENT
2023|Waters|Posters
IMPROVING ANALYSIS OF QUALITY INDICATING ATTRIBUTES FOR BETTER LIFECYCLE MANAGEMENT Robert Birdsall, Kellen DeLaney, Pawel Bigos, Tatyana Friedman Waters Corporation INTRODUCTION glutamic acid (E) acidic composition established 0 % (VSNALQSGSSQSSVTSQSSK) 10 % (VENALQSGSSQESVTSQSSK) 20 % (VENALQSGSSQESVTEQESK) emerging Intensity (%) usefulness…
Key words
bioinert, bioinertlegacy, legacytailing, tailingoutdated, outdateddeamidated, deamidatedpeptide, peptidemigration, migrationexpiring, expiringpenny, pennyacidic, acidicmetalsensitive, metalsensitiverecovery, recoverydiqmtqspstlsasvgdr, diqmtqspstlsasvgdrtpevtcvvvdvshedpevk, tpevtcvvvdvshedpevkvdnalqsgnsqesvteqdsk
Improving Peptide Mapping Studies and Reducing Assay Failures Through Reproducible Performance Using the ACQUITY Premier UPLC System (BSM)
2022|Waters|Applications
Application Note Improving Peptide Mapping Studies and Reducing Assay Failures Through Reproducible Performance Using the ACQUITY Premier UPLC System (BSM) Kellen DeLaney, Robert E. Birdsall, Ying Qing Yu Waters Corporation Abstract Reproducibility of liquid chromatography (LC) systems is critical in…
Key words
bsm, bsmpremier, premierfailures, failuresmapping, mappingacquity, acquitypeptide, peptidereducing, reducingassay, assayreproducible, reproducibleuplc, uplcimproving, improvingstudies, studiesperformance, performancethrough, throughsystem