High-sensitivity, high-throughput pesticide analysis by micro-flow LC-MS
Posters | 2024 | Thermo Fisher Scientific | HPLC SymposiumInstrumentation
The reliable detection and quantification of pesticide residues in food, water, and environmental samples are critical for ensuring public health and regulatory compliance.
High-sensitivity, high-throughput analytical methods enable laboratories to monitor a wide range of compounds while minimizing sample preparation times and operational costs.
This study compares micro-flow liquid chromatography-mass spectrometry (LC-MS) with traditional analytical-flow LC-MS for the analysis of 50 pesticide standards.
The goal is to evaluate sensitivity, chromatographic performance, solvent consumption, and sample throughput when using a 1.0 mm i.d. column at 50 µL/min versus a 2.1 mm i.d. column at 300 µL/min.
Sample Preparation
Chromatography and Mass Spectrometry
Chromatographic Performance
Sensitivity Enhancement
Solvent and Throughput Benefits
The integration of micro-flow LC-MS with automated sample handling and high-resolution mass analyzers is expected to further increase throughput and sensitivity.
Emerging developments in nano-electrospray sources and multiplexed micro-flow platforms may enable routine multi-residue screening in regulatory and industrial laboratories.
This work demonstrates that micro-flow LC-MS on a Vanquish Neo UHPLC coupled to an Orbitrap Exploris 240 offers significant sensitivity gains and solvent savings with no compromise in chromatographic performance.
The approach provides a cost-effective, environmentally friendly alternative for high-throughput pesticide analysis.
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
IndustriesEnvironmental, Food & Agriculture
ManufacturerThermo Fisher Scientific
Summary
Significance of the Topic
The reliable detection and quantification of pesticide residues in food, water, and environmental samples are critical for ensuring public health and regulatory compliance.
High-sensitivity, high-throughput analytical methods enable laboratories to monitor a wide range of compounds while minimizing sample preparation times and operational costs.
Objectives and Study Overview
This study compares micro-flow liquid chromatography-mass spectrometry (LC-MS) with traditional analytical-flow LC-MS for the analysis of 50 pesticide standards.
The goal is to evaluate sensitivity, chromatographic performance, solvent consumption, and sample throughput when using a 1.0 mm i.d. column at 50 µL/min versus a 2.1 mm i.d. column at 300 µL/min.
Methodology and Instrumentation
Sample Preparation
- A 50-pesticide standard solution at 100 pg/µL in 12.5% acetonitrile with 0.1% formic acid.
- Injection volume: 1 µL (100 pg per pesticide).
Chromatography and Mass Spectrometry
- Micro-flow configuration: Thermo Scientific Vanquish Neo UHPLC with a 1.0 mm × 100 mm Hypersil GOLD column, 1.9 µm particles, flow rate 50 µL/min.
- Analytical-flow configuration: Thermo Scientific Vanquish Flex UHPLC with a 2.1 mm × 100 mm Hypersil GOLD column, 1.9 µm particles, flow rate 300 µL/min.
- Mobile phases: Water/methanol gradient with 5 mM ammonium formate and 0.1% formic acid.
- Mass spectrometer: Thermo Scientific Orbitrap Exploris 240 in positive full-scan mode (m/z 110–1100, resolution 60,000).
Key Results and Discussion
Chromatographic Performance
- Micro-flow and analytical-flow methods produced comparable retention times and peak widths (FWHM), demonstrating no loss of separation efficiency on downscaling.
- Retention time correlation showed a linear relationship (R² = 0.978).
Sensitivity Enhancement
- Micro-flow increased peak areas by 2- to 4-fold across 50 pesticides, with some compounds showing up to 16-fold gain.
- The combination of reduced column ID and improved ionization efficiency contributed to higher peak heights and larger integrated areas.
Solvent and Throughput Benefits
- Micro-flow reduced mobile phase consumption by six-fold (from 4.5 mL to 0.75 mL per 15-min run), saving ~360 mL per day per instrument.
- Low gradient delay volume (<2 µL) allowed comparable sample throughput without sacrificing cycle time.
Benefits and Practical Applications
- Enhanced sensitivity supports trace-level quantification of pesticides in complex matrices, improving detection limits.
- Lower solvent use reduces operational costs and environmental impact.
- Method transfer is simplified by matching chromatographic profiles between flow regimes.
Future Trends and Opportunities
The integration of micro-flow LC-MS with automated sample handling and high-resolution mass analyzers is expected to further increase throughput and sensitivity.
Emerging developments in nano-electrospray sources and multiplexed micro-flow platforms may enable routine multi-residue screening in regulatory and industrial laboratories.
Conclusion
This work demonstrates that micro-flow LC-MS on a Vanquish Neo UHPLC coupled to an Orbitrap Exploris 240 offers significant sensitivity gains and solvent savings with no compromise in chromatographic performance.
The approach provides a cost-effective, environmentally friendly alternative for high-throughput pesticide analysis.
Reference
- Schilling B., et al. (2012). Molecular & Cellular Proteomics, 11(5), 202–214.
- R Core Team. (2021). R: A language and environment for statistical computing. R Foundation for Statistical Computing, Vienna, Austria.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
A tandem capillary and micro-flow LC workflow for high-throughput quantitative proteomics at near 100% mass spectrometer utilization
2024|Thermo Fisher Scientific|Posters
Poster # P-II-0441 High-throughput LC-MS A tandem capillary and micro-flow LC workflow for high-throughput quantitative proteomics at near 100% mass spectrometer utilization Runsheng Zheng1, Martin Rendl1, Christopher Pynn1, Alec Valenta2, Ece Aydin1, Maksim Daniliuk3, Robert van Ling4, Wim Decrop1, Martin…
Key words
pepmap, pepmapneo, neothroughput, throughputintercolumn, intercolumnworkflow, workflowcarryover, carryovercolumn, columnvanquish, vanquishtdi, tditandem, tandemchimerys, chimerysmicro, microextended, extendedflow, flowthermo
LC-MS: Ultra-robust micro-flow LC-MS/MS for targeted high-throughput peptide quantification using the Vanquish Neo UHPLC system
2021|Thermo Fisher Scientific|Technical notes
LC-MS Ultra-robust micro-flow LC-MS/MS for targeted high-throughput peptide quantification using the Vanquish Neo UHPLC system Authors in reduced electrospray ionization efficiency,2 which are difficult Stephan Meding, Alexander Boychenko, Runsheng Zheng, to compensate for by larger injection amounts due to the…
Key words
wash, washlsseapalfqfdlk, lsseapalfqfdlkgilfvgsgvsggeegar, gilfvgsgvsggeegarsaagafgpelsr, saagafgpelsrelasglsfpvgfk, elasglsfpvgfkltileelr, ltileelrngfildgfpr, ngfildgfprelgqsgvdtylqtk, elgqsgvdtylqtkssaapppppr, ssaappppprglilvggygtr, glilvggygtrsfanqplevvysk, sfanqplevvyskgisnegqnasik, gisnegqnasikigdyagik, igdyagikouter, outerneo
Fast, sensitive, and reproducible nano- and capillary-flow LCMS methods for high− throughput proteome profiling using the Vanquish Neo UHPLC system hyphenated with the Orbitrap Exploris 480 MS
2021|Thermo Fisher Scientific|Applications
LC-MS Fast, sensitive, and reproducible nano- and capillary-flow LCMS methods for high− throughput proteome profiling using the Vanquish Neo UHPLC system hyphenated with the Orbitrap Exploris 480 MS Authors Introduction Runsheng Zheng , Tabiwang N Arrey , Amirmansoor Hakimi ,…
Key words
neo, neowash, washpepmap, pepmapduration, durationmin, minvanquish, vanquishtrap, trapmethods, methodsthroughput, throughputcolumn, columnuhplc, uhplcmethod, methodouter, outerphase, phaseseparation
Getting started with μPAC Neo HPLC columns
2023|Thermo Fisher Scientific|Technical notes
Start-up guide | 001891 HPLC columns Getting started with µPAC Neo HPLC columns Goal Improved performance To provide a comprehensive guide for the installation of the Complementary to the first-generation micro-pillar array HPLC Thermo Scientific™ µPAC™ Neo HPLC Columns on…
Key words
µpac, µpacneo, neocolumn, columnmin, mintrap, traploading, loadingequilibration, equilibrationwash, washduration, durationflow, flowpsms, psmsgroups, groupsphase, phasevolume, volumeseparation