LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Analysis of allergens in food

Applications | 2024 | ShimadzuInstrumentation
LC/MS, Consumables, LC columns, HPLC, LC/MS/MS, LC/QQQ
Industries
Food & Agriculture
Manufacturer
Shimadzu

Summary

Significance of the Topic


Food allergens pose significant health risks; reliable analytical methods are essential to detect trace peptides that can trigger allergic reactions.

Objectives and Study Overview


The application note illustrates a targeted LC-MS/MS method to identify and quantify 17 allergen-derived peptides in food matrices using a reversed-phase Shim-pack GIST-HP C18-AQ column.

Methodology and Used Instrumentation


  • Chromatography system: Nexera X3 UHPLC with Shim-pack GIST-HP C18-AQ (100 × 2.1 mm, 1.9 μm).
  • Mobile phases: 0.1% formic acid in water (A) and in acetonitrile (B).
  • Gradient program ranging from 2% to 95% B over a 20-minute run; flow rate 0.5 mL/min.
  • Mass spectrometer: LCMS-8060NX with IonFocus ESI source operating in positive MRM mode.
  • Source parameters: nebulizing gas 2.0 L/min, drying gas 3.0 L/min, heating gas 17.5 L/min; interface 250 °C, DL 150 °C, block heater 300 °C.

Main Results and Discussion


  • All 17 target peptides were baseline-resolved within a 20-minute analytical run.
  • The method delivered high sensitivity and selectivity, with reproducible retention times for each peptide.
  • MRM transitions enabled robust quantification at trace levels relevant to food safety thresholds.

Benefits and Practical Applications


  • Rapid, multiplexed detection of allergenic peptides across diverse food samples.
  • Metal-free column provides improved peak shapes for acidic peptide targets.
  • Well-suited for QA/QC laboratories aiming to meet regulatory requirements.

Future Trends and Opportunities


Emerging high-resolution mass spectrometers, advanced data-processing algorithms, and miniaturized chromatography platforms are expected to enhance throughput, sensitivity, and adaptability for on-site allergen testing.

Conclusion


The described LC-MS/MS workflow represents a robust, sensitive, and efficient approach for monitoring food allergens, thereby supporting safer food production and consumer protection.

References


  • Shimadzu Corporation. Application News 01-00665 (JP). 2024.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Analysis of PFAS
Analysis of PFAS
2024|Shimadzu|Applications
ERAS-1000-0590 LC-MS Reversed-phase Shim-packTM Series Shim-pack GIST-HP C18 Analysis of PFAS 590 Keywords: ASTM 1. PFPrA 2. 13C4-PFBA 3. PFBA 4. PFMPA [HPLC conditions] (NexeraTM X3) Analytical column Delay column Mobile phase A Mobile phase B : : : :…
Key words
ionfocustm, ionfocustmflow, flowesi, esiphase, phaseinterface, interfacevoltage, voltageprogram, programgas, gaspacktm, packtmdraw, drawmobile, mobilepfas, pfasnebulizing, nebulizingshim, shimrate
Analysis of eicosanoids and related metabolites
ERAS-1000-0564 LC-MS Reversed-phase Shim-packTM Series Shim-pack GIST C18-AQ HP Analysis of eicosanoids and related metabolites 564 Keywords: fatty acid, plasma 1. Tetranor-PGEM-d6 2. 6-keto-PGF1α–d4 3. TXB2-d4 4. PGF2α-d4 5. PGE2–d4 6. PGD2–d4 7. LTC4-d5 8. LTD4-d5 9. PGA2-d4 10. LTB4-d4…
Key words
eicosanoids, eicosanoidsgas, gasflow, flowphase, phasepacktm, packtmmobile, mobilenebulizing, nebulizingshim, shimcid, cidmetabolites, metabolitesheating, heatingdrying, dryingreversed, reversedcolumn, columnrelated
Development of a Simultaneous Analysis Method for Allergens in Food Using a Triple Quadrupole Mass Spectrometer
Liquid Chromatograph Mass Spectrometer LCMS-8060NX Application News Development of a Simultaneous Analysis Method for Allergens in Food Using a Triple Quadrupole Mass Spectrometer Yuki Ito and Tetsuo Iida User Benefits  Enables simultaneous analysis of seven specific ingredients (wheat, buckwheat,…
Key words
food, foodaggltler, aggltlerallergens, allergensudon, udoniveleeelr, iveleeelrnoodles, noodlesinquiry, inquirywheat, wheatcurry, curryallergenic, allergenicelinswvesqtngiir, elinswvesqtngiirgqilvvpqgfavvlk, gqilvvpqgfavvlklyaeer, lyaeersvfddnvqr, svfddnvqrpeptides
Analysis of PFOA, PFHxS, and PFOS
Analysis of PFOA, PFHxS, and PFOS
2024|Shimadzu|Applications
ERAS-1000-0563 LC-MS Reversed-phase Shim-packTM Series Shim-pack GIST C18-AQ HP Analysis of PFOA, PFHxS, and PFOS 563 Keywords: organofluorinecompounds, Perfluorooctane sulfonic acid, perfluorooctanoic acid 1.PFOA 2.PFHxS 3.PFOS [HPLC conditions] (NexeraTM X3) Column : Mobile phases : Gradient program : : Flow…
Key words
flow, flowperfluorooctanoic, perfluorooctanoicpacktm, packtmgas, gaspfhxs, pfhxspfos, pfosnebulizing, nebulizingshim, shimtransition, transitionprobe, probeheating, heatingdrying, dryingreversed, reversedphases, phasescolumn
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike