Applying cDDA-eXd on a timsOmni to the analysis of the Fab regions of antibodies originating from human serum

Posters | 2025 | Bruker | ASMSInstrumentation
LC/MS, LC/MS/MS, LC/TOF, LC/HRMS, Ion Mobility
Industries
Pharma & Biopharma
Manufacturer
Bruker

Summary

Importance of Topic


The detailed characterization of antibody fragments, especially the antigen-binding Fab regions, is crucial for biopharmaceutical development and quality control.
Understanding proteoform heterogeneity and post-translational modifications in Fabs directly impacts drug safety, efficacy, and stability assessment.

Objectives and Study Overview


This work evaluates a novel top-down approach combining charge-state‐resolved data‐dependent acquisition (cDDA) with electron capture dissociation (ECD) on a Bruker timsOmni platform.
The aim was to analyze a complex mixture of six human IgG1 Fabs derived from serum, achieving high sequence coverage and unambiguous proteoform identification on an LC-MS timescale.

Methodology and Instrumentation


  • Sample Preparation: Six monoclonal IgG1 antibodies were enzymatically cleaved using hinge‐specific protease IgdE, yielding Fab fragments. Aliquots were resolved in 0.1% formic acid.
  • Liquid Chromatography: Fabs were separated on a MAbPac Capillary Reversed-Phase column with a fast gradient (23–33% to 95% acetonitrile) to distribute charge states between 33+ and 37+.
  • Mass Spectrometry: The timsOmni IMS Q-Omnitrap ToF instrument applied cDDA for on-the-fly charge deconvolution and dynamic precursor selection.
    Selected ions were accumulated in the Omnitrap cell and fragmented by ECD at low electron energy (~1 eV).
  • Data Processing: Raw spectra were interpreted with DataAnalysis and OmniScape software, enabling high-fidelity isotopic profiling and sequence assignment.

Main Results and Discussion


The charge-resolved ECD strategy yielded rich fragmentation patterns for each Fab proteoform:
  • High signal-to-noise TOF spectra were obtained by averaging kHz-rate scans, ensuring clear isotope clusters.
  • Sequential MS2 acquisitions captured complementary c- and a-type ions, improving sequence coverage across light and heavy chains.
  • Dynamic precursor scheduling minimized chimeric spectra by isolating non-overlapping charge windows.

The approach disentangled overlapping coeluting species, revealing subtle proteoform variants and modifications without digestion steps.

Benefits and Practical Applications


  • Direct top-down analysis preserves intact mass and heterogeneity, bypassing peptide assembly.
  • cDDA-ECD on the timsOmni allows untargeted profiling of complex mixtures, suitable for serum-derived or biopharmaceutical samples.
  • High analytical confidence supports batch-to-batch comparability, detection of deamidation or glyco-variants in real time.
  • Fast LC-MS timescale operation aligns with routine quality control workflows.

Future Trends and Potential Applications


Further enhancements may include:
  • Integrating electron impact dissociation (EID) to access fragmentation channels inaccessible to ECD, boosting sequence coverage in challenging regions.
  • Combining optimized LC gradients and ion mobility separation for deeper resolution of highly similar Fab proteoforms.
  • Extending cDDA-ECD workflows to full antibodies, antibody-drug conjugates, and other therapeutic proteins for comprehensive characterization.

Conclusion


This study demonstrates that cDDA-ECD on a timsOmni platform enables robust, high-resolution top-down analysis of antibody Fab fragments.
By dynamically selecting charge states and applying ECD fragmentation, the method delivers unambiguous proteoform assignments on an LC-MS timescale.
Such capabilities are invaluable for biopharmaceutical R&D, QC, and advanced proteomics research.

Used Instrumentation


  • Bruker timsOmni IMS Q-Omnitrap ToF mass spectrometer with integrated Omnitrap cell and electron gun
  • MAbPac Capillary Reversed-Phase HPLC Column
  • CaptiveSpray ion source
  • In-source collision energy (isCID) set to 40 eV
  • Dynamic charge-state DDA and low-energy ECD (~1 eV)

References


  1. den Boer MA, Greisch JF, Tamara S, Bondt A, Heck AJR. Selectivity over coverage in de novo sequencing of IgGs. Chemical Science. 2020; DOI:10.1039/d0sc03438j.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Top-down sequencing of bispecific antibodies by electron capture dissociation on a timsOmni platform
Top-down sequencing of bispecific antibodies by electron capture dissociation on a timsOmni platform Iuliia Stroganova1,2, Simon Ollivier1,2, Jean-François Greisch1,5, Athanasios Smyrnakis3, Mariangela Kosmopoulou3, Detlev Suckau4, Dimitris Papanastasiou3 and Albert J.R. Heck1,2 1Biomolecular Mass Spectrometry & Proteomics, NL, 2Netherlands Proteomics Center,…
Key words
timsomni, timsomniglycan, glycanbsabs, bsabscapture, captureomnitrap, omnitrapelectron, electronbispecific, bispecificbridges, bridgesides, idesfab, fabtop, topcqqyyrspltfgggtkveikrtvaapsvfifppsdeqlks, cqqyyrspltfgggtkveikrtvaapsvfifppsdeqlkscvrsvtprycgggfcygefdywgqgtlvtvssstkgpsvfplapssks, cvrsvtprycgggfcygefdywgqgtlvtvssstkgpsvfplapssksdown, downdisulfide
Top‐Down Mapping of Protein Modifications by Multimodal MSⁿ on the New timsOmni Platform
Top‐Down Mapping of Protein Modifications by Multimodal MSⁿ on the New timsOmni Platform Francis Berthias1, Nurgül Bilgin2, Athanasios Smyrnakis3, Mariangela Kosmopoulou3, Christian Albers4, Jasmin Mecinović2, Dimitris Papanastasiou3, and Ole N. Jensen1 1 Department of Biochemistry and Molecular Biology; 2 Department…
Key words
rcid, rcidecd, ecdeid, eidartkq, artkqatkaa, atkaaggkgl, ggkglgkgga, gkggakrhrk, krhrkprkql, prkqlrksap, rksapsgrgk, sgrgktarks, tarkstggka, tggkaakrkt, akrktflenv
Advances in hardware design and function of the new timsOmni MS platform
AS MS 2 0 2 5 – M P 4 7 1 Advances in hardware design and function of the new timsOmni MS platform D. Papanastasiou1; A. Smyrnakis1; M. Kosmopoulou1; A. Grigoriadis1; I. Orfanopoulos1; N. Manolis1; I. Panagiotopoulos1; R. Gioves1;…
Key words
eid, eidecd, ecdtims, timstimsomni, timsomniciu, ciuactivation, activationexd, exdelectron, electronomnitrap, omnitrapaccu, accuion, ionplatform, platformunfolding, unfoldingacq, acqcollisional
Top-Down Sequence Analysis of Intact Proteins Using an Agilent AdvanceBio 6545XT LC/Q-TOF with ExD
Application Note Biopharma Top-Down Sequence Analysis of Intact Proteins Using an Agilent AdvanceBio 6545XT LC/Q-TOF with ExD Authors Rachel Franklin and Mike Hare Agilent Technologies, Inc. Abstract Detailed proteoform characterization is crucial for understanding disease mode of action (MOA) and…
Key words
ecd, ecdions, ionssequence, sequencetop, topdown, downanhydrase, anhydrasecoverage, coveragecarbonic, carbonicfragmentation, fragmentationproteins, proteinscid, cidactivation, activationprotein, proteinfragment, fragmentcollisional
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike