Analysis of Allergen Proteins in Food Sample using LC-MS/MS

Posters | 2025 | Shimadzu | AOACInstrumentation
LC/MS, LC/MS/MS, LC/QQQ, LC/TOF, LC/HRMS
Industries
Food & Agriculture, Proteomics
Manufacturer
Shimadzu

Summary

Significance of the topic


The accurate detection of food allergens is critical to protect allergic consumers from severe immune reactions. Traditional methods such as ELISA and PCR may suffer from cross-reactivity or lack of protein-level specificity. LC-MS/MS offers targeted peptide-based analysis, combining high specificity and multiplex capability for allergen monitoring in complex food matrices.

Objectives and overview of the study


This study aimed to develop and validate new multiple reaction monitoring (MRM) transitions for 16 food allergens, including eight mandatory allergens in Japan and additional nuts and fruits. Calibration curves were constructed, and the method’s specificity was assessed in processed food samples spiked at defined concentrations.

Methodology and sample preparation

  • Protein extraction using proprietary allergen extraction reagents.
  • Reduction of disulfide bonds with dithiothreitol and alkylation with iodoacetamide.
  • Enzymatic digestion with trypsin aided by S-Trap cleanup.
  • Removal of reagents via solid-phase extraction, concentration by centrifugal evaporation, and reconstitution.

Instrumentation

  • Shimadzu Nexera X3 UHPLC system for peptide separation.
  • Shimadzu LCMS-9030 Q-TOF mass spectrometer for data-dependent amino acid sequence confirmation.
  • Shimadzu LCMS-8060RX triple quadrupole mass spectrometer for optimized MRM quantification.

Main results and discussion

  • Specific MRM transitions were successfully established for four nut allergens and four fruit allergens, showing linear calibration (R2 >0.995) over 1–10 mg/kg concentration range.
  • Cross-reactivity testing in processed chicken rice spiked with 16 allergens indicated minimal false positives, with interference rated on a four-tier scale; most peptides showed negligible background.
  • Peptides from orange allergen exhibited interference and were classified as unacceptable, highlighting the need for alternative targets.

Benefits and practical applications of the method

  • Simultaneous multi-allergen screening with high specificity reduces false positives from closely related proteins.
  • Quantitative results based on total protein calibration align with regulatory labeling requirements.
  • The approach complements or replaces ELISA and PCR in quality control laboratories for processed food analysis.

Future trends and potential applications

  • Development of additional MRM transitions to cover challenging allergens such as orange proteins.
  • Standardization of extraction and digestion protocols to facilitate method transfer and regulatory acceptance.
  • Integration with high-throughput automation for routine allergen surveillance in the food industry.

Conclusion


The optimized LC-MS/MS workflow provides a robust platform for targeted quantification of multiple food allergens with excellent specificity and sensitivity. Continued method refinement and standardization will support broader implementation in food safety testing.

Reference

  • Maeshima N, Tokami K, Inagaki E, Kobayashi M. Analysis of Allergen Proteins in Food Sample using LC-MS/MS. Shimadzu Corporation and Saika Technological Institute Foundation.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Simultaneous Analysis of Food Allergens, Including Nuts and Fruits, Using a Triple Quadrupole Mass Spectrometer
Liquid Chromatograph Mass Spectrometer Application News Simultaneous Analysis of Food Allergens, Including Nuts and Fruits, Using a Triple Quadrupole Mass Spectrometer Nozomi Maeshima, Manami Kobayashi User Benefits  Simultaneous detection of allergens from seven specified ingredients and ten ingredients equivalent…
Key words
unacceptable, unacceptableallergen, allergengood, goodacceptable, acceptableallergens, allergensfood, foodingredients, ingredientsnut, nutmacadamia, macadamiatransitions, transitionswalnut, walnutcashew, cashewmrm, mrmkiwifruit, kiwifruitsaika
Quantitative Determination of Fat-Soluble Vitamins in Infant Formula by LC-MS/MS Method with Supported Liquid Extraction (SLE)
Fat-soluble vitamins / LCMS-8045 Application News Quantitative Determination of Fat-Soluble Vitamins in Infant Formula by LC-MS/MS Method with Supported Liquid Extraction (SLE) Lai Kit Yee1 , Xin Jie1, Zhaoqi Zhan1 Shimadzu Asia Pacific, Singapore 1 User Benefits  A LC-MS/MS…
Key words
vitamin, vitaminfapas, fapasvitamins, vitaminssle, slesupported, supportedfat, fatestablished, establishedsoluble, solublearea, areainfant, infantrsd, rsdnews, newsscheme, schemeextraction, extractionquantifier
Quantitation of N-nitrosamines in dietary supplement by using LC-MS/MS
PO-CON23007E Quantitation of N-nitrosamines in dietary supplement by using LC-MS/MS AOAC 2023 T033 Jitendra Kelkar, Sujit Patil, Nitish Suryawanshi, Nilesh Patil, Purushottam Sutar, Pratap Rasam. Shimadzu Analytical (India) Pvt. Ltd., 1 A/B Rushabh Chambers, Makwana Road, Marol, Andheri (E), Mumbai-400059,…
Key words
ndipa, ndipandpa, ndpandma, ndmaniepa, niepanitrosamines, nitrosaminesprotein, proteinpowder, powderneipa, neipapotent, potentnitrosamine, nitrosaminearea, areadaily, dailynitrosodipropylamine, nitrosodipropylaminenitrosodiisopropylamine, nitrosodiisopropylaminetested
Development of a Simultaneous Analysis Method for Allergens in Food Using a Triple Quadrupole Mass Spectrometer
Liquid Chromatograph Mass Spectrometer LCMS-8060NX Application News Development of a Simultaneous Analysis Method for Allergens in Food Using a Triple Quadrupole Mass Spectrometer Yuki Ito and Tetsuo Iida User Benefits  Enables simultaneous analysis of seven specific ingredients (wheat, buckwheat,…
Key words
food, foodaggltler, aggltlerallergens, allergensudon, udoniveleeelr, iveleeelrnoodles, noodlesinquiry, inquirywheat, wheatcurry, curryallergenic, allergenicelinswvesqtngiir, elinswvesqtngiirgqilvvpqgfavvlk, gqilvvpqgfavvlklyaeer, lyaeersvfddnvqr, svfddnvqrpeptides
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike