Development of a Simultaneous Analysis Method for Allergens in Food Using a Triple Quadrupole Mass Spectrometer
Posters | 2025 | Shimadzu | AOACInstrumentation
Food allergies pose significant health risks worldwide, and stringent labeling regulations demand reliable methods to detect trace levels of allergenic proteins in complex food matrices. Traditional techniques such as ELISA and PCR face limitations in multiplexing capability and specificity, motivating the development of advanced analytical approaches.
This work aimed to establish a rapid, sensitive, and selective method for the simultaneous quantification of eight priority allergens (wheat, buckwheat, egg, milk, peanut, shrimp, crab, and soy) in processed foods. The study outlines sample preparation, chromatographic separation, and mass spectrometric detection strategies to achieve robust multiplex analysis.
Standard extracts of target allergenic proteins were subjected to reduction, alkylation, and trypsin digestion, followed by solid-phase extraction cleanup. The resulting peptide mixtures were separated on reversed-phase HPLC under a 10.5-minute gradient and analyzed via multiple reaction monitoring (MRM). A total of 48 MRM transitions targeting 17 signature peptides enabled concurrent detection with a calibration range of 0.1–50 ppm.
All eight allergenic peptides exhibited sharp, well-resolved peaks within the chromatographic run time. Calibration curves demonstrated excellent linearity and sensitivity, exemplified by the crustacean peptide AGGLTLER. Application to commercial food samples showed no false positives in pre-packaged curry or baby food, while wheat peptides were correctly identified in udon noodles, confirming alignment with product labels.
Advancements may include expanding the peptide panel to cover additional allergens, integrating high-resolution mass spectrometry for enhanced specificity, automating sample preparation workflows, and deploying real-time monitoring solutions in food production environments. Such developments will further strengthen food safety and compliance assurance.
A robust LC-MS/MS method using triple quadrupole instrumentation was successfully developed for the simultaneous detection of eight key food allergens. Demonstrated accuracy and speed in real food matrices underscore its value for routine allergen screening in food quality control laboratories.
LC/MS, LC/MS/MS, LC/QQQ
IndustriesFood & Agriculture
ManufacturerShimadzu
Summary
Importance of the Topic
Food allergies pose significant health risks worldwide, and stringent labeling regulations demand reliable methods to detect trace levels of allergenic proteins in complex food matrices. Traditional techniques such as ELISA and PCR face limitations in multiplexing capability and specificity, motivating the development of advanced analytical approaches.
Objectives and Study Overview
This work aimed to establish a rapid, sensitive, and selective method for the simultaneous quantification of eight priority allergens (wheat, buckwheat, egg, milk, peanut, shrimp, crab, and soy) in processed foods. The study outlines sample preparation, chromatographic separation, and mass spectrometric detection strategies to achieve robust multiplex analysis.
Used Instrumentation
- NexeraTM X3 high-performance liquid chromatograph
- Shimadzu LCMS-8060NX triple quadrupole mass spectrometer
Methodology
Standard extracts of target allergenic proteins were subjected to reduction, alkylation, and trypsin digestion, followed by solid-phase extraction cleanup. The resulting peptide mixtures were separated on reversed-phase HPLC under a 10.5-minute gradient and analyzed via multiple reaction monitoring (MRM). A total of 48 MRM transitions targeting 17 signature peptides enabled concurrent detection with a calibration range of 0.1–50 ppm.
Main Results and Discussion
All eight allergenic peptides exhibited sharp, well-resolved peaks within the chromatographic run time. Calibration curves demonstrated excellent linearity and sensitivity, exemplified by the crustacean peptide AGGLTLER. Application to commercial food samples showed no false positives in pre-packaged curry or baby food, while wheat peptides were correctly identified in udon noodles, confirming alignment with product labels.
Benefits and Practical Applications
- Enables simultaneous monitoring of multiple allergens in a single analysis
- Reduces false positives and improves specificity compared to immunoassays
- Short run time enhances laboratory throughput for QA/QC and regulatory testing
Future Trends and Potential Applications
Advancements may include expanding the peptide panel to cover additional allergens, integrating high-resolution mass spectrometry for enhanced specificity, automating sample preparation workflows, and deploying real-time monitoring solutions in food production environments. Such developments will further strengthen food safety and compliance assurance.
Conclusion
A robust LC-MS/MS method using triple quadrupole instrumentation was successfully developed for the simultaneous detection of eight key food allergens. Demonstrated accuracy and speed in real food matrices underscore its value for routine allergen screening in food quality control laboratories.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Development of a Simultaneous Analysis Method for Allergens in Food Using a Triple Quadrupole Mass Spectrometer
2025|Shimadzu|Applications
Liquid Chromatograph Mass Spectrometer LCMS-8060NX Application News Development of a Simultaneous Analysis Method for Allergens in Food Using a Triple Quadrupole Mass Spectrometer Yuki Ito and Tetsuo Iida User Benefits Enables simultaneous analysis of seven specific ingredients (wheat, buckwheat,…
Key words
food, foodaggltler, aggltlerallergens, allergensudon, udoniveleeelr, iveleeelrnoodles, noodlescurry, currywheat, wheatinquiry, inquiryallergenic, allergenicelinswvesqtngiir, elinswvesqtngiirgqilvvpqgfavvlk, gqilvvpqgfavvlklyaeer, lyaeersvfddnvqr, svfddnvqrpeptides
Simultaneous Analysis of Food Allergens, Including Nuts and Fruits, Using a Triple Quadrupole Mass Spectrometer
2026|Shimadzu|Applications
Liquid Chromatograph Mass Spectrometer Application News Simultaneous Analysis of Food Allergens, Including Nuts and Fruits, Using a Triple Quadrupole Mass Spectrometer Nozomi Maeshima, Manami Kobayashi User Benefits Simultaneous detection of allergens from seven specified ingredients and ten ingredients equivalent…
Key words
unacceptable, unacceptableallergen, allergengood, goodacceptable, acceptableallergens, allergensfood, foodingredients, ingredientsnut, nutmacadamia, macadamiatransitions, transitionswalnut, walnutcashew, cashewmrm, mrmpeach, peachbanana
Analysis of Allergen Genes in Food Using a Microchip Electrophoresis System
2026|Shimadzu|Applications
Microchip Electrophoresis System MultiNA II MCE-301 Application News Analysis of Allergen Genes in Food Using a Microchip Electrophoresis System Hitomi Tsujihata, Nozomi Maeshima, and Yuji Sogabe User Benefits Allergen testing in food is available efficiently. The DNA fingerprinting…
Key words
allergen, allergenconfectionery, confectioneryelectrophoresis, electrophoresiswalnut, walnutdna, dnafingerprinting, fingerprintingfood, foodinquiry, inquiryallergens, allergenspcr, pcrwheat, wheatgene, genemultina, multinamicrochip, microchipprimer
Simultaneous analysis of major allergens in food matrices by high sensitive mass spectrometer
2017|Shimadzu|Posters
PO-CON1758E Simultaneous analysis of major allergens in food matrices by high sensitive mass spectrometer ASMS 2017 TP 202 Tairo Ogura1 Shimadzu Scientific Instruments, Inc. Columbia, MD, USA Simultaneous analysis of major allergens in food matrices by high sensitive mass spectrometer…
Key words
allergens, allergensfood, foodgluten, glutenallergenic, allergeniccod, coddetect, detectlabel, labelcracker, crackerbread, breadshrimp, shrimpmatrices, matricesmajor, majorpeanuts, peanutssimultaneous, simultaneousatrantic