Enhanced Recovery and Peak Shape of Acidic Peptides with BioResolve™ 1 mm ID Columns with MaxPeak™ Premier Technology
Applications | 2026 | WatersInstrumentation
Proteomics workflows depend on sensitive and reproducible detection of peptide analytes including acidic species that often suffer non specific adsorption. Improving recovery and peak shape for these molecules is essential for accurate quantitation and workflow efficiency.
This study assesses 1 mm internal diameter reversed phase columns incorporating MaxPeak High Performance Surfaces technology against conventional stainless steel columns. The primary aims are to evaluate acidic peptide recovery, peak quality, conditioning requirements, and compatibility with both microflow and analytical UHPLC systems.
A MassPREP Enolase Digest with Phosphopeptides Mix was prepared in 0.1 percent formic acid. Chromatography was performed at 60 °C on ACQUITY UPLC M-Class and ACQUITY Premier systems with flow rates between 10 and 100 µL/min using a formic acid/acetonitrile gradient. Detection employed positive mode ESI on a Xevo G3 QTof. Software included MassLynx for acquisition and waters_connect for system control.
Total ion chromatograms indicated similar resolution and peak capacity for both column types. Extracted ion chromatograms for representative acidic and phosphopeptides showed that HPS columns delivered high recovery and symmetrical peaks from the first injection, whereas stainless steel columns required multiple conditioning cycles to match performance. Column to column reproducibility on three HPS columns yielded retention time RSDs below 1 percent and peak area RSDs below 10 percent. Performance was maintained across microflow and analytical UHPLC platforms with expected effects of post column dispersion.
Surface treated chromatography hardware is poised to become standard for challenging analytes in proteomics. Further developments may integrate ion mobility separation and advanced acquisition modes to deepen phosphoproteome coverage. The drive toward sustainable microflow methods will continue in large scale, clinical, and high throughput studies.
BioResolve 1 mm ID columns with MaxPeak Premier technology effectively mitigate non specific adsorption of acidic peptides, delivering superior recovery and peak shape from initial use. Their robust performance, reproducibility, and compatibility across LC platforms support sensitive and sustainable proteomics workflows.
1 Gao Y et al Front Bioeng Biotechnol 2020 8 1 13
2 Lennon S et al J Proteome Res 2021 20 1705 1715
3 Nguyen JM Rzewuski SC Lauber MA Waters App Note 2021 720007211
4 Reed C Wong N Birdsall RE Waters App Note 2023 720008136
LC/MS, Consumables, LC columns, LC/MS/MS, LC/TOF, LC/HRMS
IndustriesProteomics
ManufacturerWaters
Summary
Significance of the Topic
Proteomics workflows depend on sensitive and reproducible detection of peptide analytes including acidic species that often suffer non specific adsorption. Improving recovery and peak shape for these molecules is essential for accurate quantitation and workflow efficiency.
Objectives and Study Overview
This study assesses 1 mm internal diameter reversed phase columns incorporating MaxPeak High Performance Surfaces technology against conventional stainless steel columns. The primary aims are to evaluate acidic peptide recovery, peak quality, conditioning requirements, and compatibility with both microflow and analytical UHPLC systems.
Methodology and Instrumentation
A MassPREP Enolase Digest with Phosphopeptides Mix was prepared in 0.1 percent formic acid. Chromatography was performed at 60 °C on ACQUITY UPLC M-Class and ACQUITY Premier systems with flow rates between 10 and 100 µL/min using a formic acid/acetonitrile gradient. Detection employed positive mode ESI on a Xevo G3 QTof. Software included MassLynx for acquisition and waters_connect for system control.
- Columns tested
- BioResolve Peptide C18 RP MaxPeak Premier 1 mm ID 1.7 µm 300 Å BEH, 50 mm
- ACQUITY Peptide BEH C18 1 mm ID 1.7 µm 300 Å stainless steel, 50 mm
- LC Systems
- ACQUITY UPLC M-Class with microflow plumbing
- ACQUITY Premier UPLC with standard UHPLC plumbing
- Mass Spectrometer
- Xevo G3 QTof with low flow ESI probe
Main Results and Discussion
Total ion chromatograms indicated similar resolution and peak capacity for both column types. Extracted ion chromatograms for representative acidic and phosphopeptides showed that HPS columns delivered high recovery and symmetrical peaks from the first injection, whereas stainless steel columns required multiple conditioning cycles to match performance. Column to column reproducibility on three HPS columns yielded retention time RSDs below 1 percent and peak area RSDs below 10 percent. Performance was maintained across microflow and analytical UHPLC platforms with expected effects of post column dispersion.
Benefits and Practical Applications
- Enhanced recovery and peak shape of acidic and phosphopeptides with minimal conditioning
- Equivalent separation performance to stainless steel hardware
- High reproducibility enabling reliable method transfer
- Compatibility with both microflow and standard UHPLC workflows
- Lower solvent consumption reduces operating costs and environmental impact
Future Trends and Potential Applications
Surface treated chromatography hardware is poised to become standard for challenging analytes in proteomics. Further developments may integrate ion mobility separation and advanced acquisition modes to deepen phosphoproteome coverage. The drive toward sustainable microflow methods will continue in large scale, clinical, and high throughput studies.
Conclusion
BioResolve 1 mm ID columns with MaxPeak Premier technology effectively mitigate non specific adsorption of acidic peptides, delivering superior recovery and peak shape from initial use. Their robust performance, reproducibility, and compatibility across LC platforms support sensitive and sustainable proteomics workflows.
Reference
1 Gao Y et al Front Bioeng Biotechnol 2020 8 1 13
2 Lennon S et al J Proteome Res 2021 20 1705 1715
3 Nguyen JM Rzewuski SC Lauber MA Waters App Note 2021 720007211
4 Reed C Wong N Birdsall RE Waters App Note 2023 720008136
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Benchmarking Resolution and Recovery of BioResolve™ 1 mm ID C18 RP Columns with MaxPeak™ Premier Technology
2026|Waters|Applications
Application Note Benchmarking Resolution and Recovery of BioResolve™ 1 mm ID C18 RP Columns with MaxPeak™ Premier Technology Caitlin M. Hanna, Stephan M. Koza, Balasubrahmanyam Addepalli Waters Corporation, United States Published on March 11, 2026 Abstract The BioResolve Peptide C18…
Key words
technology, technologypremier, premieracidic, acidicrecovery, recoverypeptide, peptidemaxpeak, maxpeakshape, shapehladpsk, hladpsknvplpyk, nvplpykvnqigptlsepsik, vnqigptlsepsikieeelgdnavfagenfhhgdk, ieeelgdnavfagenfhhgdkieeelgdnavfagenfhhgdkl, ieeelgdnavfagenfhhgdklphosphorlyated, phosphorlyatedprivacy, privacyvnqigptlsesik
Improving Chromatographic Separations Of Biopharmaceuticals With MaxPeak High Performance Surfaces (HPS) Technology
2023|Waters|Brochures and specifications
Improving Chromatographic Separations Of Biopharmaceuticals With MaxPeak High Performance Surfaces (HPS) Technology Analytical Solutions Using MaxPeak High Performance Surfaces (HPS) Technology for Biopharmaceutical Therapeutics Biopharmaceutical therapeutics have consistently been the fastest growing segment within the pharmaceutical space and require advances…
Key words
premier, premieracquity, acquityglycan, glycanmaxpeak, maxpeaknucleotide, nucleotideculture, culturehps, hpspeptide, peptideintact, intactsystem, systembioaccord, bioaccordcolumn, columnread, readprotein, proteinglycans
Increased Sensitivity for LC-MS Analysis of Phosphopeptides on an ACQUITY QDa Detector Using XSelect Premier Columns
2021|Waters|Applications
Application Note Increased Sensitivity for LC-MS Analysis of Phosphopeptides on an ACQUITY QDa Detector Using XSelect Premier Columns Kenneth D. Berthelette, Jennifer M. Nguyen, Kim Haynes Waters Corporation Abstract Absorptive losses have been known to occur with phosphorylated peptides using…
Key words
maxpeak, maxpeakphosphopeptides, phosphopeptidespremier, premierxselect, xselectsurfaces, surfaceshps, hpscolumns, columnsacquity, acquityrecovery, recoveryundetectable, undetectableenolase, enolaselewis, lewisuplc, uplcadsorptive, adsorptivetruview
Improved Chromatographic Performance with a PREMIER Peptide C18 Column Versus a Titanium-Lined C18 Column Technology
2020|Waters|Applications
Application Note Improved Chromatographic Performance with a PREMIER Peptide C18 Column Versus a Titanium-Lined C18 Column Technology Maureen DeLoffi, Jennifer M. Nguyen, Gary Izzo, Matthew A. Lauber, Mike Savaria Waters Corporation This is an Application Brief and does not contain…
Key words
premier, premiertitanium, titaniumpeptide, peptidelined, linedacquity, acquitycolumn, columnmassprep, massprepphosphopeptide, phosphopeptideversus, versussummed, summedpeak, peakpeptides, peptidesmetal, metalhigher, highershape