Password reset
Password reset

Confident peptide mapping and disulfide bond analysis of an IgG2 monoclonal antibodyApplications | 2020 | Thermo Fischer ScientificInstrumentation
Proteomics , Clinical Research
Thermo Fischer Scientific
Key words
interchain, disulfide, peptide, mapping, kccvecppcpappvagpsvflfppkpk, ptms, intrachain, kingfisher, nibrt, abundance, thermo, bonds, sequence, relative, confident, bond, level, ptm, duo, identification, scientific, translational, intra, biopharmaceutical, minutes, demonstrate, digest, assays, reduced, coverage, atlscr, dyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssnfgtqtytcnvdhkpsntk, gpsvfplapcsr, lepedfavfycqqygsspr, lscaasgftfssyamswvr, stsestaalgclvk, tpevtcvvvdvshedpevqfnwyvdgvevhnak, smart, aedtavyycak, hkvyacevthqglsspvtk, gec, sgtasvvcllnnfypr, kits, wqqgnvfscsvmhealhnhytqk, nqvsltclvk, confirm, hinge, folding, confidence, protein

Confident peptide mapping and disulfide bond analysis of an IgG2 monoclonal antibodyApplications | 2020 | Thermo Fischer ScientificInstrumentation
Proteomics , Clinical Research
Thermo Fischer Scientific
Key words
interchain, disulfide, peptide, mapping, kccvecppcpappvagpsvflfppkpk, ptms, intrachain, kingfisher, nibrt, abundance, thermo, bonds, sequence, relative, confident, bond, level, ptm, duo, identification, scientific, translational, intra, biopharmaceutical, minutes, demonstrate, digest, assays, reduced, coverage, atlscr, dyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssnfgtqtytcnvdhkpsntk, gpsvfplapcsr, lepedfavfycqqygsspr, lscaasgftfssyamswvr, stsestaalgclvk, tpevtcvvvdvshedpevqfnwyvdgvevhnak, smart, aedtavyycak, hkvyacevthqglsspvtk, gec, sgtasvvcllnnfypr, kits, wqqgnvfscsvmhealhnhytqk, nqvsltclvk, confirm, hinge, folding, confidence, protein


Related content

Development of a Method for Multipesticide Analysis Using the Agilent 1260 Infinity Analytical SFC System with Triple Quadrupole MS Detection

| 2017 | Agilent Technologies
Agilent Technologies
Food & Agriculture

Improving Drug Metabolite Identification in Biofluids with the ACQUITY PREMIER and Hybrid Organic Surface Technology: Increased Sensitivity and Reproducibility

| 2021 | Waters
Clinical Research

Analysis of Kakkonto by Nexera-e and SPD-M30A Photodiode Array Detector (Part 1)

| 2015 | Shimadzu
Pharma & Biopharma

Related content

Development of a Method for Multipesticide Analysis Using the Agilent 1260 Infinity Analytical SFC System with Triple Quadrupole MS Detection

| 2017 | Agilent Technologies
Agilent Technologies
Food & Agriculture

Improving Drug Metabolite Identification in Biofluids with the ACQUITY PREMIER and Hybrid Organic Surface Technology: Increased Sensitivity and Reproducibility

| 2021 | Waters
Clinical Research

Analysis of Kakkonto by Nexera-e and SPD-M30A Photodiode Array Detector (Part 1)

| 2015 | Shimadzu
Pharma & Biopharma
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use

LabRulez s.r.o., all rights reserved.