Unambiguous di-sulphide bond assignment in synthetic peptides Linaclotide and Plecanatide using Agilent 6546/6550 LC-QTOF High Resolution Mass Spectrometer
Posters | 2020 | Agilent TechnologiesInstrumentation
Disulfide bonds play a crucial role in stabilizing the three-dimensional structure and biological activity of cysteine-rich peptides. In therapeutic peptides such as Linaclotide and Plecanatide, correct pairing of cysteine residues is essential for efficacy and safety. Analytical methods that can unambiguously map these linkages are key for process development and quality control in peptide manufacturing.
This study demonstrates a robust workflow for assigning the disulfide connectivity in synthetic Linaclotide (three disulfide bridges) and Plecanatide (two disulfide bridges). By combining controlled partial reduction, selective cyanylation, site-specific cleavage and high-resolution LC-QTOF mass spectrometry, the researchers aimed to identify signature peptide fragments corresponding to each disulfide bond.
This targeted approach enables:
Advancements may include:
The described LC-QTOF MS workflow provides a reliable platform for unambiguous disulfide bond assignment in synthetic peptides. Through selective reduction, cyanylation, and targeted cleavage, it delivers clear MS/MS signatures for each linkage, supporting stringent quality control in peptide therapeutics.
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesProteomics
ManufacturerAgilent Technologies
Summary
Importance of the topic
Disulfide bonds play a crucial role in stabilizing the three-dimensional structure and biological activity of cysteine-rich peptides. In therapeutic peptides such as Linaclotide and Plecanatide, correct pairing of cysteine residues is essential for efficacy and safety. Analytical methods that can unambiguously map these linkages are key for process development and quality control in peptide manufacturing.
Objectives and Overview of the Study
This study demonstrates a robust workflow for assigning the disulfide connectivity in synthetic Linaclotide (three disulfide bridges) and Plecanatide (two disulfide bridges). By combining controlled partial reduction, selective cyanylation, site-specific cleavage and high-resolution LC-QTOF mass spectrometry, the researchers aimed to identify signature peptide fragments corresponding to each disulfide bond.
Instrumentation
- Agilent 6546 or 6550 LC-QTOF high-resolution mass spectrometer
- Agilent 1290 Infinity II UPLC system
Methodology
- Partial reduction of individual disulfide bonds using optimized ratios of TCEP to peptide.
- Cyanylation of free cysteines with CDAP to introduce +50 Da mass shift per modification.
- Fractionation of cyanylated peptides by reversed-phase UPLC and manual collection.
- Selective cleavage at cyanylated cysteines under alkaline conditions (1 M ammonia, 6 M guanidine-HCl, 25 °C, 25 min).
- High-resolution MS and MS/MS analysis to confirm fragment masses and sequences.
Key Results and Discussion
- In Linaclotide, stepwise reduction increased the intact mass by 2 Da per bond. Cyanylation added 50 Da per reduced cysteine pair. MS/MS spectra of the resulting fragments confirmed the three native linkages: Cys1–Cys6, Cys2–Cys10 and Cys5–Cys13.
- Diagnostic fragment pairs for each Linaclotide bond were observed with accurate masses matching theoretical values (e.g., CCEY C at 643.16 Da and CNPACTGCY at 955.31 Da for Cys1–Cys6).
- Plecanatide analysis similarly revealed two disulfide connections. Partial reduction and cyanylation followed by MS/MS identified Cys4–Cys12 and Cys7–Cys15 by detecting signature fragments such as CTGCL (520.18 Da) and CELCVNVA (874.37 Da).
Benefits and Practical Applications
This targeted approach enables:
- Unambiguous mapping of disulfide patterns without exhaustive reduction/alkylation workflows.
- Rapid quality assessment of synthetic peptides in R&D and manufacturing settings.
- High confidence in peptide conformation and consistency for therapeutic applications.
Future Trends and Opportunities
Advancements may include:
- Automation of reduction/cyanylation/cleavage steps to increase throughput.
- Software tools integrating MS/MS data for automated disulfide assignment.
- Extension to larger cysteine-rich proteins using top-down or ion mobility-enabled workflows.
- Coupling with orthogonal methods (e.g., NMR, X-ray) for structural validation.
Conclusion
The described LC-QTOF MS workflow provides a reliable platform for unambiguous disulfide bond assignment in synthetic peptides. Through selective reduction, cyanylation, and targeted cleavage, it delivers clear MS/MS signatures for each linkage, supporting stringent quality control in peptide therapeutics.
References
- Góngora-Benítez M, Tulla-Puche J, Paradís-Bas M, Werbitzky O, Giraud M, Albericio F. Optimized Fmoc solid-phase synthesis of the cysteine-rich peptide linaclotide. Biopolymers. 2011;96(1):69–80. doi:10.1002/bip.21480
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Agilent ASMS 2020 Posters Book
2020|Agilent Technologies|Posters
Poster Reprint ASMS 2020 MP 176 Using ICP-MS/MS with M-Lens for the analysis of high silicon matrix samples Yu Ying1; Xiangcheng Zeng1 1Agilent China Technologies, China, Shanghai, Introduction The expansion of the connected devices and the Internet of Things (IoT)…
Key words
peptide, peptidereprint, reprintwere, wereposter, postermethod, methoddiscussion, discussionpositive, positiveresults, resultsclassification, classificationboth, bothusing, usingexperimental, experimentalanalysis, analysisrecovery, recoverysample
Disulfide Bond Identification of Biotherapeutic Proteins Using Various Fragmentation Techniques Available on an Orbitrap Fusion Tribrid Mass Spectrometer
2016|Thermo Fisher Scientific|Posters
Poster Note 64 8 0 8 Disulfide Bond Identification of Biotherapeutic Proteins Using Various Fragmentation Techniques Available on an Orbitrap Fusion Tribrid Mass Spectrometer Disulfide Disulfide bond bond identification identification of of biotherapeutic biotherapeutic prot prot Fusion Fusion Tribrid Tribrid…
Key words
disulfide, disulfidehcd, hcdreduced, reducedfragmentation, fragmentationdependent, dependentests, estsdis, disavailab, availabdisu, disudata, databond, bondtribrid, tribridfusion, fusionacquisition, acquisitionbiotherapeutic
Robust and reproducible peptide mapping and intact mass analysis workflows on a single instrument platform
2017|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21688 Robust and reproducible peptide mapping and intact mass analysis workflows on a single instrument platform Authors Amy Farrell , Kai Scheffler , Ken Cook 2, Martin Samonig2, David Munoz2, Alexander Schwahn2, and Jonathan Bones1 1 Characterisation and…
Key words
somatotropin, somatotropinpeptide, peptidedigestion, digestiondisulfide, disulfidepeptides, peptidescleavage, cleavagemissed, missedprotein, proteinnative, nativesequence, sequencemodifications, modificationsmapping, mappingdigest, digestabundance, abundancedeamidation
Automatic Protein Disulfide Bond Mapping of a Monoclonal Antibody Using the Agilent Accurate-Mass Q-TOF LC/MS Platform and BioConfirm Software Algorithm
2016|Agilent Technologies|Applications
Automatic Protein Disulfide Bond Mapping of a Monoclonal Antibody Using the Agilent Accurate-Mass Q-TOF LC/MS Platform and BioConfirm Software Algorithm Application Note Biotherapeutics and Biosimilars Authors Introduction David L. Wong, Stephen Madden, and Monoclonal antibodies (mAbs) are a very important…
Key words
disulfide, disulfidelysc, lysctrypsin, trypsinscore, scorebond, bondbonds, bondslinkages, linkagesherceptin, herceptinmapping, mappingthtcppcpapellggpsvflfppk, thtcppcpapellggpsvflfppkpeptides, peptidescounts, countsaedtavyycsr, aedtavyycsrnonreduced, nonreducedlscaasgfnik