Agilent 6546 LC/Q-TOF: Gaining Higher Confidence and Throughput in Metabolite Analysis

Technical notes | 2019 | Agilent TechnologiesInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Industries
Metabolomics
Manufacturer
Agilent Technologies

Summary

Significance of the Topic


The rapid growth of metabolomics demands analytical platforms capable of handling large sample sets with minimal or no chromatography while maintaining high confidence in compound identification. Instruments that combine fast acquisition rates with superior mass resolution and accuracy allow researchers to profile complex biological extracts more efficiently, supporting applications in systems biology, clinical research, and industrial quality control.

Study Objectives and Overview


This study evaluates the performance of the Agilent 6546 LC/Q-TOF mass spectrometer in flow injection analysis of Escherichia coli metabolome extracts. The primary goals are to assess its resolving power, mass accuracy, sensitivity, intrascan dynamic range, and isotopic fidelity, and to compare feature coverage with a prior-generation instrument under high-throughput conditions.

Methodology and Instrumentation


Sample Preparation and Analysis
  • E. coli cells grown on glucose minimal medium and extracted with ethanol.
  • Flow injection of 1.5 µL extract using an Agilent Infinity II pump and restrictive capillary.
  • Negative-mode MS acquisition at 1.5 Hz over m/z 50–1,000.

Instrument Configuration
  • Agilent 6546 LC/Q-TOF tuned for high resolution and mass accuracy.
  • 10 GHz analog-to-digital converter (ADC) acquisition system.

Main Results and Discussion


Resolution and Mass Accuracy
  • Achieved >30,000 resolution (FWHM) for ions above m/z 118 and >60,000 at m/z 1,521, independent of ion intensity.
  • Mass errors consistently within ±0.3 mDa across the mass range.

Sensitivity and Coverage
  • Stable detection across an 81-fold dilution series; precision declines only at the highest dilution.
  • In a standard 1X concentration, more metabolites were detected compared to the Agilent 6550 iFunnel Q-TOF.

Intrascan Dynamic Range
  • Spanning four orders of magnitude (10^4–10^8 counts) in a single spectrum without loss of resolution or accuracy.

Isotopic Resolution and Fidelity
  • Clear separation of proximal ^13C and ^2H isotopologues in crowded m/z regions.
  • Relative isotopic accuracy errors below 20% for most features, even at low intensities.

Benefits and Practical Applications


The enhanced capabilities of the 6546 LC/Q-TOF support chromatography-free metabolite profiling at high throughput, enabling confident molecular formula assignment and simultaneous quantification of low- and high-abundance compounds. This expands analytical capacity in metabolomics, pharmaceutical screening, and industrial process monitoring.

Future Trends and Potential Uses


Emerging directions include integration with automated sample handling and machine-learning-driven data analysis, coupling with microfluidic or ion mobility separations for added specificity, deployment in clinical and field environments for near-real-time metabolomics, and continued improvements in acquisition electronics for even broader dynamic range and sensitivity.

Conclusion


The Agilent 6546 LC/Q-TOF demonstrates superior resolution, accuracy, sensitivity, dynamic range, and isotopic fidelity in flow injection metabolomics. Its performance advances high-throughput analysis of complex biological samples without chromatography, delivering higher confidence in metabolite detection and quantification.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Conquering Orbital Ion Trap Limitations
Conquering Orbital Ion Trap Limitations
2021|Agilent Technologies|Brochures and specifications
Conquering Orbital Ion Trap Limitations The proven data-quality demonstrating the exceptional capabilities of the Agilent 6546 LC/Q-TOF Escape the Trap for Excellent Spectral Data Unlike ion traps that only emphasize mass resolution and mass accuracy, the Agilent 6546 LC/Q-TOF delivers…
Key words
fidelity, fidelityisotope, isotopeoutstanding, outstandingdynamic, dynamicisotopologues, isotopologuesconstant, constantresolution, resolutionproductivity, productivitywide, wideprecision, precisionhigher, higherratio, ratioincreased, increasedcharge, chargerange
Agilent 6546 LC/Q-TOF - Discovery Metabolomics for Greater Biological Insight
Agilent 6546 LC/Q-TOF - Discovery Metabolomics for Greater Biological Insight
2021|Agilent Technologies|Brochures and specifications
Discovery Metabolomics for Greater Biological Insight Agilent 6546 LC/Q-TOF Introduction Endogenous metabolites reflect the functional state of a biological system. Profiling endogenous metabolites can be analytically challenging due to the complexity of biological systems. Agilent is a world leader in…
Key words
metabolomics, metabolomicslipid, lipiddiscovery, discoverymasshunter, masshuntermetabolites, metabolitesbiological, biologicaldiphosphod, diphosphodsuite, suitevisualization, visualizationagilent, agilentmetabolite, metabolitefluorescein, fluoresceingriseofulvin, griseofulvinunivariate, univariatesimvastatin
Metabolomics Analysis of Tuberculosis Drug Activity Using an Agilent 6545 Q-TOF LC/MS
Metabolomics Analysis of Tuberculosis Drug Activity Using an Agilent 6545 Q-TOF LC/MS Application Note Metabolomics Authors Abstract Travis E. Hartman1 and Kyu Y. Rhee1,2 Tuberculosis (TB) is both the leading cause of deaths due to an infectious 1 Division of…
Key words
pza, pzametabolites, metabolitesprofinder, profindermpp, mppmetabolite, metaboliteswarm, swarmpathway, pathwayria, riatuberculosis, tuberculosisbiological, biologicalajs, ajstreated, treatedautotune, autotunefeature, featuremass
Q-RAI Provides Rapid and Sensitive Data Independent Acquisition for Peptide Quantitation
Poster Reprint ASMS 2021 Poster number MO030 Q-RAI Provides Rapid and Sensitive Data Independent Acquisition for Peptide Quantitation Karen E. Yannell1, Christopher M. Colangelo2, Wendi A. Hale2 1 Agilent, 2 Santa Clara, CA Agilent, Lexington, MA Introduction Experimental Data-independent acquisition…
Key words
rai, raiunmodified, unmodifiedvsnkalpapiek, vsnkalpapiekdiqmtqspstlsasvgdr, diqmtqspstlsasvgdrdata, dataindependent, independentfragment, fragmentdtlmisr, dtlmisroxidation, oxidationacquisition, acquisitionmodified, modifieddia, diamprophet, mprophetwindows, windowshigh
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike