Forced-degradation evaluation of erythromycin by HPLC and single quadrupole mass spectrometry

Applications | 2020 | Thermo Fisher ScientificInstrumentation
LC/MS, LC/SQ
Industries
Pharma & Biopharma
Manufacturer
Thermo Fisher Scientific

Summary

Importance of the Topic


Erythromycin is a widely used antibiotic whose low UV absorbance and complex impurity profile make stability and purity assessment challenging. Forced‐degradation studies help predict degradation pathways and support formulation development, regulatory submissions, and quality control.

Objectives and Study Overview


This work aimed to design a straightforward, stability‐indicating liquid chromatography–mass spectrometry (LC-MS) method for erythromycin. The method compares impurity profiles of a reference standard and acid‐stressed erythromycin, demonstrating that MS detection enhances impurity identification without extensive method optimization.

Methodology and Instrumentation


Sample preparation involved dissolving erythromycin standards and generating an acid‐degraded sample by exposure to 1 N HCl followed by quenching with NaHCO₃. Chromatographic separation used a Thermo Scientific Acclaim PolarAdvantage II column (3 µm, 3 × 150 mm) with a water/formic acid and methanol/water/formic acid gradient at 425 µL/min. Mass detection was performed on a Thermo Scientific ISQ EM single quadrupole in positive mode, with both full‐scan (350–1050 m/z) and selective ion monitoring (SIM) channels for known variants and impurities.

Instrumental Setup


  • Vanquish Core Binary HPLC (pump, autosampler at 4 °C, column compartment at 40 °C)
  • ISQ EM single quadrupole mass spectrometer with Autospray source (optimized for thermal lability at 250 °C ion transfer)
  • Chromeleon 7.3 CDS for data acquisition and processing

Results and Discussion


Initial method development used the European Pharmacopeia system suitability standard. Tuning the ion source temperature minimized in-source fragmentation of erythromycin A (m/z 734.47) and enabled clear detection of related variants (e.g., m/z 718.47 for erythromycin B). Chromatographic conditions resolved erythromycin B from co-eluting impurities at m/z 716.4. In stressed samples, additional degradation products appeared (m/z 576–584 and 540 ranges), and five new low-molecular-weight impurities were observed. Relative impurity levels increased significantly under acidic stress, while the main API peak remained quantifiable by SIM despite minor co-elutions.

Benefits and Practical Applications


  • Fit-for-purpose LC-MS method requiring minimal HPLC optimization
  • Sensitive impurity profiling with < 3 µg injection, reducing sample consumption
  • Mass‐selective detection overcomes co-elution and low UV absorbance challenges
  • Rapid identification of forced‐degradation products without reference standards

Future Trends and Opportunities


High-resolution mass spectrometry could further elucidate structural details of unknown degradation products. Automated method development and advanced data‐processing algorithms will accelerate impurity identification. Extending this approach to other poorly UV-absorbing APIs and adopting greener solvents can enhance sustainability in pharmaceutical analysis.

Conclusion


The presented LC-MS approach offers a robust, low-effort solution for erythromycin stability testing. It delivers clear impurity profiles with minimal sample and method development, making it a valuable tool in early drug development and quality control.

Reference


  1. European Pharmacopoeia monograph 0179: Erythromycin.
  2. EDQM Information Leaflet: Erythromycin for system suitability CRS.
  3. Chitneni SK et al., J. Chromatogr. A 1056 (2004) 111–120.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Forced-degradation evaluation of erythromycin by HPLC and single quadrupole mass spectrometry
APPLICATION NOTE 73365 Forced-degradation evaluation of erythromycin by HPLC and single quadrupole mass spectrometry Authors: Mauro De Pra, Stephan Meding Thermo Fisher Scientific, Germering, Germany Keywords: Vanquish Core, ISQ EC, ISQ EM, antibiotics, pharmaceutical analysis, stability studies Goal Develop a…
Key words
erythromycin, erythromycinimpurity, impuritystressed, stressedlability, labilitymass, massforced, forcedwere, weresst, sstbased, basedsource, sourcescientific, scientificscan, scanisq, isqthermo, thermodetection
Achieve confident impurity detection with the Thermo Scientific ISQ EC single quadrupole mass spectrometer
APPLICATION NOTE 72391 Achieve confident impurity detection with the Thermo Scientific ISQ EC single quadrupole mass spectrometer Authors Goal Stephan Meding, Katherine Lovejoy, Martin Ruehl Thermo Fisher Scientific, Germering, Germany Demonstrate quantitative impurity analysis with the Thermo Scientific™ ISQ™ EC™…
Key words
tenofovir, tenofoviradenine, adeninedisoproxil, disoproxilemtricitabine, emtricitabineisoproxil, isoproxilcounts, countsintensity, intensityisq, isqimpurity, impuritysim, simmass, massvanquish, vanquishcid, cidtime, timevoltage
Confident and sensitive identification of semaglutide degradation products and impurities using a UHPLC-HRAM MS platform
Application note | 003920 Pharma Confident and sensitive identification of semaglutide degradation products and impurities using a UHPLC-HRAM MS platform Authors Application benefits Xuepu Li1, Xiaoxi Zhang1, Min Du2, Roberto Gamez , Sylvia Grosse 3 • The Thermo Scientific™ Hypersil…
Key words
semaglutide, semaglutidehaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgoxidation, oxidationpeptide, peptidedegradation, degradationstressed, stressedimpurities, impuritiesproducts, productsoxidative, oxidativehaegftsdvssylegqaakefiawlvrgrg, haegftsdvssylegqaakefiawlvrgrguhplc, uhplchram, hramfinder, finderbiopharma, biopharmaaegtftsdvssylegqaakefiawlvrgrg
Compliance-ready LC-UV-MS-based monitoring of antibody quality attributes using a single quadrupole mass spectrometer
Technical note | 003308 Pharma / Biopharma Compliance-ready LC-UV-MS-based monitoring of antibody quality attributes using a single quadrupole mass spectrometer Authors Application benefits Sylvia Grosse1, Michaela S. Scherz1, • The Thermo Scientific™ ISQ™ EM Single Quadrupole Mass Spectrometer (SQMS) enables…
Key words
digest, digestadalimumab, adalimumabsqms, sqmspeptide, peptidebeads, beadstrypsin, trypsinirc, ircsmart, smartmass, masssst, sstisq, isqcds, cdsfunctionality, functionalitytime, timespectrometer
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike