IMPROVE SPEED AND ACCURACY OF MONOCLONAL ANTIBODY BIOANALYSIS USING NANOTECHNOLOGY AND LCMS
Others | | ShimadzuInstrumentation
Monoclonal antibodies (mAbs) are among the top‐selling therapeutics for treating autoimmune disorders and various cancers. Accurate bioanalysis of mAbs is essential to determine pharmacokinetic and pharmacodynamic profiles, optimize dosing regimens, and ensure safety and efficacy during drug development and clinical monitoring.
This work introduces nSMOL (nano‐surface and molecular‐orientation limited proteolysis), a nanotechnology‐enabled method combined with liquid chromatography–mass spectrometry (LC–MS/MS) to accelerate and enhance the precision of mAb bioanalysis. The approach aims to simplify sample preparation, increase selectivity for antibody fragments, and enable multiplex quantitation of multiple therapeutic antibodies in plasma.
nSMOL employs an immunoglobulin‐binding resin coated with Protein A ligands to capture intact antibodies from biological matrices. Following two wash cycles, trypsin immobilized on nanoparticles is added; its size restricts digestion to the Fab region protruding from nano‐wells, yielding signature peptides.
Instrumentation
Peptides are directly injected into the LC–MS/MS for multiple reaction monitoring (MRM). The entire workflow, from digestion to data acquisition, can be completed in about five minutes per sample.
nSMOL demonstrated:
nSMOL offers:
Emerging directions include:
The nSMOL approach, combining nanotechnology and LC–MS/MS, offers a universal, fast, and highly selective bioanalysis platform for mAbs and related biotherapeutics. It addresses limitations of ligand binding assays and conventional LC–MS workflows and supports robust PK/PD and ADC quantification in drug development.
LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerShimadzu
Summary
Importance of the Topic
Monoclonal antibodies (mAbs) are among the top‐selling therapeutics for treating autoimmune disorders and various cancers. Accurate bioanalysis of mAbs is essential to determine pharmacokinetic and pharmacodynamic profiles, optimize dosing regimens, and ensure safety and efficacy during drug development and clinical monitoring.
Goals and Study Overview
This work introduces nSMOL (nano‐surface and molecular‐orientation limited proteolysis), a nanotechnology‐enabled method combined with liquid chromatography–mass spectrometry (LC–MS/MS) to accelerate and enhance the precision of mAb bioanalysis. The approach aims to simplify sample preparation, increase selectivity for antibody fragments, and enable multiplex quantitation of multiple therapeutic antibodies in plasma.
Methodology and Instrumentation
nSMOL employs an immunoglobulin‐binding resin coated with Protein A ligands to capture intact antibodies from biological matrices. Following two wash cycles, trypsin immobilized on nanoparticles is added; its size restricts digestion to the Fab region protruding from nano‐wells, yielding signature peptides.
Instrumentation
- Triple quadrupole LC–MS/MS system (Shimadzu LCMS-8060)
- Immunoglobulin collection resin with Protein A ligands
- Trypsin‐immobilized nanoparticles
Peptides are directly injected into the LC–MS/MS for multiple reaction monitoring (MRM). The entire workflow, from digestion to data acquisition, can be completed in about five minutes per sample.
Key Results and Discussion
nSMOL demonstrated:
- High reproducibility and quantitative repeatability due to selective Fab‐only digestion
- Significant reduction of background noise and ion suppression compared to traditional LC–MS/MS workflows
- Elimination of denaturation, reduction, alkylation, and solid‐phase extraction steps
- Full method validation for Trastuzumab, Nivolumab, Bevacizumab, and an antibody‐drug conjugate (Brentuximab vedotin)
- Successful multiplex analysis of at least three mAbs in a single plasma sample
Benefits and Practical Applications
nSMOL offers:
- Streamlined sample preparation without capture antibodies or ligands
- Rapid method development at lower cost
- Compliance with FDA and Japan MHLW bioanalytical guidelines
- Capability to perform multiplex PK/PD studies in preclinical and clinical settings
Future Trends and Opportunities
Emerging directions include:
- Application to bispecific and next‐generation antibody formats
- Integration with high‐resolution mass spectrometry for top‐down proteomics
- Automation and high‐throughput sample processing in regulated labs
- Real‐time monitoring of therapeutic antibodies in clinical trials
Conclusion
The nSMOL approach, combining nanotechnology and LC–MS/MS, offers a universal, fast, and highly selective bioanalysis platform for mAbs and related biotherapeutics. It addresses limitations of ligand binding assays and conventional LC–MS workflows and supports robust PK/PD and ADC quantification in drug development.
References
- LC–MS Bioanalysis of Trastuzumab using Fab‐selective proteolysis nSMOL, Shimadzu application note
- LC–MS Bioanalysis of Nivolumab using Fab‐selective proteolysis nSMOL, Shimadzu application note
- LC–MS Bioanalysis of Bevacizumab using Fab‐selective proteolysis nSMOL, Shimadzu application note
- Multiplex LC–MS Bioanalysis of Antibody Drugs using Fab‐selective proteolysis nSMOL, Shimadzu application note
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
LCMS Bioanalysis of Antibody Drugs Using Fab-selective Proteolysis “nSMOL Method” — Selection of Signature Peptide —
2017|Shimadzu|Applications
C146-E340 LCMS Bioanalysis of Antibody Drugs Using Fab-selective Proteolysis “nSMOL Method” Technical Report — Selection of Signature Peptide — Noriko Iwamoto1, Takashi Shimada1 A b s tra c t: nSMOL (nano-surface and molecular-orientation limited proteolysis) is Shimadzu's completely new, proprietary,…
Key words
ctx, ctxbrx, brxifx, ifxrtx, rtxnsmol, nsmolfab, fabsignature, signatureifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls, ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslspellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkp, pellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflysklt, ppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytl, reeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlvdksrwqqgnvfscsvmhealhnhytqkslslspgk, vdksrwqqgnvfscsvmhealhnhytqkslslspgkantibody, antibodyimmunoglobulin, immunoglobulintrypsin
Bioanalytical assessment of Cetuximab in Wistar rat plasma using nSMOL and LCMS-8060
2011|Shimadzu|Applications
LC/MS nSMOL and Liquid Chromatography Mass Spectrometry LC-31-ADI-54 Bioanalytical assessment of Cetuximab in Wistar rat plasma using nSMOL and LCMS-8060 ■ Introduction Cetuximab is a human monoclonal antibody (mAb) for the treatment of metastatic colorectal carcinoma, head and neck cancer.…
Key words
nsmol, nsmolcetuximab, cetuximabfab, fabrat, ratproteolysis, proteolysismab, mabwistar, wistarantibody, antibodyplasma, plasmansmoltm, nsmoltmbioanalysis, bioanalysisselective, selectivebioanalytical, bioanalyticalnano, nanosingular
Shimadzu Solutions for Biopharmaceutical - Application Notebook
2018|Shimadzu|Guides
C10G-E054 Solutions for Biopharmaceutical Application Notebook First Edition: December, 2017 © Shimadzu Corporation, 2017 Solutions for Biopharmaceutical Index Application Notebook Bioanalysis LCMS Bioanalysis of Antibody Drugs Using Fab-Selective Proteolysis nSMOL - Trastuzumab analysis nSMOL, which enables selective proteolysis of the…
Key words
acid, acidamino, aminoantibody, antibodyglycan, glycannsmol, nsmolerexim, ereximstructure, structurenews, newsaggregates, aggregatesmrm, mrmanalysis, analysisnucleic, nucleicglycans, glycanssizer, sizerconfirmation
Biopharmaceutical Development and QA/QC
|Shimadzu|Guides
A Sponsored Supplement From Biopharmaceutical Development and QA/QC Applications Compendium www.shimadzu.com 2 S p o ns o r e d F e a tu r e Introduction This Applications Compendium reviews analytical needs for characterization of biopharmaceuticals at different…
Key words
acid, acidamino, aminonucleic, nucleicvitamin, vitaminnsmol, nsmolculture, cultureprotein, proteinproteolysis, proteolysisbioanalysis, bioanalysisother, otherglycan, glycanantibody, antibodyanalysis, analysiscarbohydrate, carbohydratedata