Monitoring Product Quality Attributes of Biotherapeutics at the Peptide Level Using the Agilent InfinityLab LC/MSD XT System
Applications | 2019 | Agilent TechnologiesInstrumentation
LC/MS, LC/SQ
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Key wordscdr, nistmab, pqas, attributes, infinitylab, openlab, stress, deamidation, msd, oxidation, chemstation, deamidated, peptide, monitoring, tkpreeqynstyr, multiple, peptides, gfypsdiavewesngqpennyk, time, min, using, glycopeptide, agilent, monoclonal, eics, vtnmdpadtatyycar, diqmtqspstlsasvgdr, reporting, tryptic, dtlmisr, scan, induced, system, intelligent, glycopeptides, single, processing, data, storage, oxidized, edition, biotherapeutic, category, interest, central, product, biopharmaceutical, map, provides, esgpalvkptqtltltctfsgfslstagmsvgwir
Similar PDF
Peptide Mapping - Agilent BioHPLC Columns Application Compendium
|Agilent Technologies|Guides
Agilent-NISTmAb Peptide Mapping Agilent BioHPLC Columns Application Compendium Contents Agilent-NISTmAb Standard (P/N 5191-5744; 5191-5745) was aliquoted from NISTmAb RM 8671 batch. Quality control (QC) testing is performed using Agilent LC-MS system. QC batch release test includes aggregate profile, charge variants…
Key words
peptide, peptidemapping, mappingpage, pagecontents, contentsback, backadvancebio, advancebiocdr, cdrpeptides, peptidesassaymap, assaymapmin, minagilent, agilentmap, mappqas, pqasattributes, attributesmsd
Agilent BioHPLC Columns - Characterization of NIST Monoclonal Antibody Critical Quality Attributes - Application Compendium
2019|Agilent Technologies|Guides
Agilent BioHPLC Columns Characterization of NIST Monoclonal Antibody Critical Quality Attributes Application Compendium Contents Agilent-NISTmAb Standard (P/N 5191-5744; 5191-5745) was aliquoted from NISTmAb RM 8671 batch. Quality control (QC) testing is performed using Agilent LC-MS system. QC batch release test…
Key words
mab, mabglycan, glycanadvancebio, advancebiocounts, countsmapping, mappingpeptide, peptidemonoclonal, monoclonalagilent, agilentglycans, glycansmin, mincolumn, columnprotein, proteinmass, massnistmab, nistmabassaymap
Monitoring Multiple Attributes in a Single Assay Using the ACQUITY QDa Detector for Product Confirmation and Process Monitoring of Product Quality Attributes
2017|Waters|Applications
[ APPLICATION NOTE ] Monitoring Multiple Attributes in a Single Assay Using the ACQUITY QDa Detector for Product Confirmation and Process Monitoring of Product Quality Attributes Brooke M. Koshel, Robert E. Birdsall, and Ying Qing Yu Waters Corporation, Milford, MA,…
Key words
cdr, cdrattributes, attributesqda, qdaacquity, acquitymonitoring, monitoringmultiple, multipledeamidated, deamidateddetector, detectorsingle, singlepeptides, peptidesassay, assayproduct, productusing, usinguplc, uplcmodifications
A high-resolution accurate mass multi-attribute method for critical quality attribute monitoring and new peak detection
2019|Thermo Fisher Scientific|Applications
APPLICATION NOTE 72916 A high-resolution accurate mass multi-attribute method for critical quality attribute monitoring and new peak detection Authors Haichuan Liu1, Royston Quintyn2, John Rontree3 Thermo Fisher Scientific 1 San Jose, CA 2 West Palm Beach, FL 3 Hemel Hempstead,…
Key words
intensity, intensitynistmab, nistmabmam, mamchromeleon, chromeleonpeptide, peptideprtc, prtcstressed, stressedratio, ratiothermo, thermofinder, finderscientific, scientificretention, retentioncounts, countsbiopharma, biopharmaintegration