Online affinity and digestion: A flexible and robust tool for the characterization and quantification of proteins
Posters | 2014 | ShimadzuInstrumentation
HPLC
IndustriesProteomics
ManufacturerShimadzu
Key wordsproteins, characterization, quantification, affinity, skyline, perfinity, immobilized, count, transitions, sumtic, labsolutions, directly, imer, capture, workstation, using, plagued, peptide, area, gpsvfplapssk, vvsvltvlhqdwlngk, dtlmisr, targeted, without, concentration, favorable, contributed, data, acknowledge, reactor, facilitated, assistance, import, team, enzyme, subsequently, anti, enrichment, predicted, lack, antibodies, implementation, cid, output, eluted, files, coverage, discovery, digestion, acknowledgements
Similar PDF
A Rapid and Reproducible Immuno-MS Platform from Sample Collection to Quantitation of IgG
2014|Shimadzu|Posters
PO-CON1457E A Rapid and Reproducible Immuno-MS Platform from Sample Collection to Quantitation of IgG ASMS 2014 ThP766 Rachel Lieberman1, David Colquhoun1, Jeremy Post1, Brian Feild1, Scott Kuzdzal1, Fred Regnier2, 1 Shimadzu Scientific Instruments, Columbia, MD, USA 2 Novilytic L.L.C, North…
Key words
immuno, immunoigg, iggttppvldsdgsfflysk, ttppvldsdgsfflyskvvsvltvlhqdwlngk, vvsvltvlhqdwlngkcollection, collectionplatform, platformrapid, rapidreproducible, reproducibleplamsa, plamsacards, cardsnoviplex, noviplexquantitation, quantitationsample, sampleplasma, plasmablood
A Single Injection LC-MS Analysis Scheme for Simultaneous Analysis of Biotherapeutics and Host-Cell Impurities via Online Digestion LC-MS/MS
2019|Shimadzu|Posters
A Single Injection LC-MS Analysis Scheme for Simultaneous Analysis of Biotherapeutics and Host-Cell Impurities via Online Digestion LC-MS/MS Novel Aspect Fully automated online protein digestion, affinity pulldown, intact mass analysis, peptide mapping of target therapeutics and host-cell proteins in a…
Key words
igg, iggsigma, sigmadigestion, digestionaffinity, affinityhost, hostcell, cellscheme, schemeonline, onlinebiotherapeutics, biotherapeuticsprotein, proteinlysate, lysateimpurities, impuritiesproteins, proteinsvia, viaxic
Rapid Automated Peptide Mapping
2019|Thermo Fisher Scientific|Presentations
Rapid Automated Peptide Mapping Kate Erickson Application Scientist The world leader in serving science Why is there a growth in biotherapeutics? • 8/10 drugs in 2016 Biologics • Biopharma growing rapidly ~10% over the next 5 years • $160 Billion…
Key words
digest, digestdigestion, digestionsmart, smartprotein, proteinthermo, thermoscientific, scientificstreptavidin, streptavidinenzyme, enzymedenaturation, denaturationcapture, captureaffinity, affinitypeptide, peptideimmuno, immunoagarose, agaroseimmobilized
Automating Sample Preparation Workflows for Hybrid LC-MS/MS Bioanalysis of Protein Therapeutics: Quantification of Etanercept Using Affinity Purification and Digestion
2019|Waters|Applications
[ APPLICATION NOTE ] Automating Sample Preparation Workflows for Hybrid LC-MS/MS Bioanalysis of Protein Therapeutics: Quantification of Etanercept Using Affinity Purification and Digestion Paula Orens and Mary Lame Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION Automating a hybrid LC-MS/MS…
Key words
protein, proteinautomating, automatingbioanalysis, bioanalysistherapeutics, therapeuticshybrid, hybridautomated, automatedictcrpgwycalsk, ictcrpgwycalskworkflows, workflowsimmunoaffinity, immunoaffinitypreparation, preparationpurification, purificationetanercept, etanerceptmanual, manualnormalized, normalizedraw