Online affinity and digestion: A flexible and robust tool for the characterization and quantification of proteins
Posters | 2014 | ShimadzuInstrumentation
The characterization and quantification of proteins by mass spectrometry is essential for biomarker discovery, clinical diagnostics and quality control in biopharmaceutical production. Traditional offline workflows for proteolytic digestion and immunoaffinity enrichment often suffer from poor reproducibility, manual variability and lengthy protocols. Implementing a fully online, automated system addresses these limitations by streamlining sample processing, reducing hands-on time and improving quantitative precision.
This work presents a front-to-end automated solution combining online affinity capture, proteolytic digestion and LC-MS/MS analysis. Key aims include demonstrating flexibility of the platform for both discovery and targeted assays, optimizing system parameters for different proteins, and evaluating reproducibility, sensitivity and throughput.
Online Affinity and Digestion Workflow
Data-Dependent Discovery
• Fully automated, end-to-end workflow reduces hands-on time and operator error
• Rapid method development supports both discovery and routine quantitative assays
• High reproducibility (CV < 8 %) and sensitivity facilitate biomarker validation
• Flexibility to adapt to different affinity ligands and target proteins
• Integration with multiplexed immunoaffinity columns for broader biomarker panels
• Further miniaturization to reduce sample and reagent consumption
• Real-time process monitoring in biomanufacturing pipelines
• Application to complex clinical samples such as plasma and tissue lysates
The automated online affinity and digestion platform provides a robust, flexible solution for both protein discovery and targeted quantification. By coupling selective enrichment, rapid proteolysis and seamless transfer between discovery and triple quadrupole MS, the system achieves high sequence coverage, precise quantification and minimal manual intervention, supporting accelerated biomarker research and quality control workflows.
No external literature references were cited in the original document.
HPLC
IndustriesProteomics
ManufacturerShimadzu
Summary
Significance of Topic
The characterization and quantification of proteins by mass spectrometry is essential for biomarker discovery, clinical diagnostics and quality control in biopharmaceutical production. Traditional offline workflows for proteolytic digestion and immunoaffinity enrichment often suffer from poor reproducibility, manual variability and lengthy protocols. Implementing a fully online, automated system addresses these limitations by streamlining sample processing, reducing hands-on time and improving quantitative precision.
Study Objectives and Overview
This work presents a front-to-end automated solution combining online affinity capture, proteolytic digestion and LC-MS/MS analysis. Key aims include demonstrating flexibility of the platform for both discovery and targeted assays, optimizing system parameters for different proteins, and evaluating reproducibility, sensitivity and throughput.
Methodology and Instrumentation
Online Affinity and Digestion Workflow
- Capture of target protein from crude sample onto immobilized antibody or Protein G columns
- Direct elution onto an immobilized enzyme reactor for rapid proteolysis
- Reversed-phase peptide separation and MS analysis without manual transfer steps
- Perfinity Workstation for automated valve switching, column control and temperature regulation
- Immobilized anti-hemoglobin column for selective capture of hemoglobin variants
- Immobilized enzyme reactor for on-column digestion at controlled temperature
- Shimadzu LCMS-IT-TOF for data-dependent MS/MS discovery experiments
- Shimadzu LCMS-8050 triple quadrupole for targeted peptide MRM quantification
- Digestion time and temperature to balance sequence coverage and throughput
- Washing stringency to minimize non-specific binding
- Gradient length and flow rate for peptide separation
- MRM transition selection and collision energy optimization using Skyline
Key Results and Discussion
Data-Dependent Discovery
- Hemoglobin variants digested in under 4 minutes at 40 ˚C yielded nearly 100 % sequence coverage at 5 % FDR
- Top 3 DDA method on a 15-minute gradient resolved isoform-specific peptides
- Sickle cell and wild-type hemoglobin peptides quantified with coefficients of variation below 8 %
- Five minute gradients on the LCMS-8050 achieved sensitive and reproducible quantification
- Protein G capture, automated digestion and targeted MRM in under one hour
- Monitoring of twelve constant and variable region peptides across a concentration range with R2 > 0.995
Benefits and Practical Applications
• Fully automated, end-to-end workflow reduces hands-on time and operator error
• Rapid method development supports both discovery and routine quantitative assays
• High reproducibility (CV < 8 %) and sensitivity facilitate biomarker validation
• Flexibility to adapt to different affinity ligands and target proteins
Future Trends and Potential Applications
• Integration with multiplexed immunoaffinity columns for broader biomarker panels
• Further miniaturization to reduce sample and reagent consumption
• Real-time process monitoring in biomanufacturing pipelines
• Application to complex clinical samples such as plasma and tissue lysates
Conclusion
The automated online affinity and digestion platform provides a robust, flexible solution for both protein discovery and targeted quantification. By coupling selective enrichment, rapid proteolysis and seamless transfer between discovery and triple quadrupole MS, the system achieves high sequence coverage, precise quantification and minimal manual intervention, supporting accelerated biomarker research and quality control workflows.
Reference
No external literature references were cited in the original document.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
A Rapid and Reproducible Immuno-MS Platform from Sample Collection to Quantitation of IgG
2014|Shimadzu|Posters
PO-CON1457E A Rapid and Reproducible Immuno-MS Platform from Sample Collection to Quantitation of IgG ASMS 2014 ThP766 Rachel Lieberman1, David Colquhoun1, Jeremy Post1, Brian Feild1, Scott Kuzdzal1, Fred Regnier2, 1 Shimadzu Scientific Instruments, Columbia, MD, USA 2 Novilytic L.L.C, North…
Key words
immuno, immunoigg, iggttppvldsdgsfflysk, ttppvldsdgsfflyskvvsvltvlhqdwlngk, vvsvltvlhqdwlngkcollection, collectionplatform, platformrapid, rapidreproducible, reproducibleplamsa, plamsacards, cardsnoviplex, noviplexquantitation, quantitationsample, sampleplasma, plasmablood
A Single Injection LC-MS Analysis Scheme for Simultaneous Analysis of Biotherapeutics and Host-Cell Impurities via Online Digestion LC-MS/MS
2019|Shimadzu|Posters
A Single Injection LC-MS Analysis Scheme for Simultaneous Analysis of Biotherapeutics and Host-Cell Impurities via Online Digestion LC-MS/MS Novel Aspect Fully automated online protein digestion, affinity pulldown, intact mass analysis, peptide mapping of target therapeutics and host-cell proteins in a…
Key words
igg, iggsigma, sigmadigestion, digestionaffinity, affinityhost, hostcell, cellscheme, schemeonline, onlinebiotherapeutics, biotherapeuticslysate, lysateprotein, proteinimpurities, impuritiesproteins, proteinsvia, viaxic
Rapid Automated Peptide Mapping
2019|Thermo Fisher Scientific|Presentations
Rapid Automated Peptide Mapping Kate Erickson Application Scientist The world leader in serving science Why is there a growth in biotherapeutics? • 8/10 drugs in 2016 Biologics • Biopharma growing rapidly ~10% over the next 5 years • $160 Billion…
Key words
digest, digestdigestion, digestionsmart, smartprotein, proteinthermo, thermostreptavidin, streptavidinscientific, scientificdenaturation, denaturationenzyme, enzymecapture, captureaffinity, affinitypeptide, peptideimmuno, immunoagarose, agaroseimmobilized
Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis
2013|Shimadzu|Posters
PO-CON1362E Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis ASMS 2013 TP-756 Rachel Lieberman1, Brian Feild1, Kevin Meyer2, Nick Herold2, Scott Kuzdzal1, Kevin Meyer2, Nick Herold2 1 Shimadzu Scientific Instruments, Columbia, MD 2 Perfinity Biosciences, Inc., West Lafeyette,…
Key words
umtic, umticallergen, allergenimer, imerovercoming, overcomingprotein, proteinfood, foodmin, mintrypsin, trypsindigestion, digestionchallenges, challengessample, sampleextract, extractsfnldeghalr, sfnldeghalrperfinity, perfinitydesalting