In-depth Peptide Mapping of Monoclonal Antibody (mAb) by A de novo Peptide Sequencing Method on Q-TOF Mass Spectrometer with Data-independent Acquisition
Applications | 2019 | ShimadzuInstrumentation
Peptide mapping is essential for detailed primary structure characterization of monoclonal antibodies (mAbs), enabling detection of single amino acid changes and post-translational modifications (PTMs). A robust, unbiased workflow improves the accuracy and reproducibility of biopharmaceutical quality control.
This study demonstrates an integrated data-independent acquisition (DIA) approach on the Shimadzu LCMS-9030 Q-TOF mass spectrometer for de novo peptide sequencing of a bevacizumab biosimilar, aiming to verify the complete primary sequence and identify any structural alterations without relying solely on comparative reference maps.
Sample Preparation:
Instrumental Setup:
The workflow extracted 11 852 mass features, leading to confident identification of 61 tryptic peptides (42 heavy-chain and 19 light-chain) covering 100% of the mAb sequence. The example peptide ALPAPIEK exhibited clear matching of extracted MS/MS fragments to predicted transitions, validating the de novo sequencing capability. Observations included PTMs such as N-glycosylation and C-terminal lysine processing.
Advancements may include machine learning-driven spectral interpretation for automated de novo sequencing, integration of real-time PTM monitoring, expansion of DIA methods to other large biomolecules, and streamlined QC workflows incorporating high-throughput peptide mapping.
The described DIA strategy on the LCMS-9030 Q-TOF provides a straightforward, high-coverage approach for de novo peptide sequencing of mAbs, offering significant benefits for biopharmaceutical characterization and quality control.
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesPharma & Biopharma
ManufacturerShimadzu
Summary
Significance of the Topic
Peptide mapping is essential for detailed primary structure characterization of monoclonal antibodies (mAbs), enabling detection of single amino acid changes and post-translational modifications (PTMs). A robust, unbiased workflow improves the accuracy and reproducibility of biopharmaceutical quality control.
Study Objectives and Overview
This study demonstrates an integrated data-independent acquisition (DIA) approach on the Shimadzu LCMS-9030 Q-TOF mass spectrometer for de novo peptide sequencing of a bevacizumab biosimilar, aiming to verify the complete primary sequence and identify any structural alterations without relying solely on comparative reference maps.
Methodology and Instrumentation
Sample Preparation:
- Denaturation and reduction: bevacizumab digested in Tris-HCl buffer with ProteaseMAX and DTT.
- Alkylation: iodoacetamide treatment.
- Enzymatic digestion: overnight trypsin incubation.
- Quenching: trifluoroacetic acid addition.
Instrumental Setup:
- Liquid chromatography: Shimadzu Nexera X2 UHPLC with Shim-pack GISS-HP (3 μm, 150 × 3.0 mm) column at 40 °C, gradient from 0% to 75% acetonitrile over 35 min.
- Mass spectrometry: Shimadzu LCMS-9030 Q-TOF with heated electrospray interface, full-scan MS (100–2000 m/z) and MS/MS DIA segments covering 210–1690 m/z in 40 m/z windows.
- Data processing: MS-DIAL for peak extraction, Skyline for theoretical y and b ion transition prediction.
Results and Discussion
The workflow extracted 11 852 mass features, leading to confident identification of 61 tryptic peptides (42 heavy-chain and 19 light-chain) covering 100% of the mAb sequence. The example peptide ALPAPIEK exhibited clear matching of extracted MS/MS fragments to predicted transitions, validating the de novo sequencing capability. Observations included PTMs such as N-glycosylation and C-terminal lysine processing.
Benefits and Practical Applications
- Unbiased fragmentation: DIA captures all fragment ions without precursor selection, enhancing sequence coverage.
- Comprehensive mapping: full amino acid coverage and detection of PTMs supports in-depth characterization.
- Improved reproducibility: standardized UHPLC-Q-TOF conditions reduce variability in comparative analyses.
- Regulatory compliance: robust primary structure confirmation aligns with biopharma quality requirements.
Future Trends and Opportunities
Advancements may include machine learning-driven spectral interpretation for automated de novo sequencing, integration of real-time PTM monitoring, expansion of DIA methods to other large biomolecules, and streamlined QC workflows incorporating high-throughput peptide mapping.
Conclusion
The described DIA strategy on the LCMS-9030 Q-TOF provides a straightforward, high-coverage approach for de novo peptide sequencing of mAbs, offering significant benefits for biopharmaceutical characterization and quality control.
References
- Searle BC, Pino LK (2018) Chromatogram libraries improve peptide detection and quantification by data independent acquisition mass spectrometry. Nat Commun 9:5128.
- Riken MS-DIAL software for metabolomics and DIA processing.
- MacLean B et al. Skyline: an open source document editor for targeted proteomics.
- Shimadzu (2019) Peptide mapping of monoclonal antibody using LCMS-9030 Q-TOF. Application News AD-0212B.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Data-independent Acquisition (DIA) Approach on Q-TOF Mass Spectrometry for In-depth Peptide Mapping of Monoclonal Antibodies
2020|Shimadzu|Posters
MP 117 A Data-independent Acquisition (DIA) Approach on Q-TOF Mass Spectrometry for In-depth Peptide Mapping of Monoclonal Antibodies Yonghai Lu1, Wesgie Oh Wen Qi2, Zhaoqi Zhan1 1, Shimadzu (Asia Pacific), Singapore. 2, National University of Singapore, Singapore. 1. Overview 4.…
Key words
peptide, peptidedial, dialbevacizumab, bevacizumabnovo, novosequencing, sequencingdia, diamabs, mabsdrugbank, drugbankproposed, proposedantibodies, antibodiesmonoclonal, monoclonalmapping, mappingnumbers, numbersindependent, independentalpapiek
Disulfide Bond Characterization of Monoclonal Antibody (mAb) Using Q-TOF Mass Spectrometer
2019|Shimadzu|Applications
Application News Biopharma / LCMS-9030 (Q-TOF) Disulfide Bond Characterization of Monoclonal Antibody (mAb) Using Q-TOF Mass Spectrometer No. AD-0214 Yonghai Lu and Zhaoqi Zhan Application Development & Support Centre, Shimadzu (Asia Pacific), Singapore ❑ Introduction Monoclonal antibody (mAb) is emerging…
Key words
disulfide, disulfidebond, bondnovo, novobiosimilar, biosimilarchain, chainpeptide, peptidemab, mabsequencing, sequencingreduced, reducednews, newslinkages, linkagesbevacizumab, bevacizumablcms, lcmsadduct, adductdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyicnv
LC/MS/MS Peptide Mapping Comparison of Innovator and Biosimilars of Rituximab
2019|Agilent Technologies|Applications
Application Note Biotherapeutics and Biosimilars LC/MS/MS Peptide Mapping Comparison of Innovator and Biosimilars of Rituximab Author Suresh Babu C.V. Agilent Technologies, Inc. Abstract The development and manufacturing of biosimilars require comparability studies with innovator biotherapeutic products. This Application Note presents…
Key words
innovator, innovatorpeptide, peptidecounts, countschain, chainmapping, mappingbiosimilar, biosimilarcharge, chargeunmodified, unmodifiedptms, ptmsheavy, heavyassaymap, assaymapttppvldsdgsfflyskl, ttppvldsdgsfflysklbiosimilars, biosimilarsmabs, mabsbravo
Structure Characterization and Differentiation of Biosimilar and Reference Products Using Unique Combination of Complementary Fragmentation Mechanisms
2014|Thermo Fisher Scientific|Posters
Structure Characterization and Differentiation of Biosimilar and Reference Products Using Unique Combination of Complementary Fragmentation Mechanisms Zhiqi Hao,1 Chen Li, 2 Shiaw-Lin Wu, 2,3 David M. Horn1 and Jonathan Josephs1 1 Thermo Fisher Scientific, San Jose, CA; 2BioAnalytix Inc, Cambridge,…
Key words
tnk, tnkglycosylation, glycosylationggnm, ggnmglycoforms, glycoformspeptide, peptideggn, ggnbiosimilar, biosimilarhcd, hcdtpa, tpaspectrum, spectrumsggn, sggnetd, etdnhnycr, nhnycrnycr, nycrycr