In-depth Peptide Mapping of Monoclonal Antibody (mAb) by A de novo Peptide Sequencing Method on Q-TOF Mass Spectrometer with Data-independent Acquisition
Applications | 2019 | ShimadzuInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesPharma & Biopharma
ManufacturerShimadzu
Key wordspeptide, dia, mab, novo, mapping, bevacizumab, chain, sequencing, alpapiek, peptides, tryptic, news, dial, monoclonal, heavy, amino, depth, transitions, primary, structure, trypsin, diqmtqspsslsasvgdrvtitcsasqdisnyl, efault, evqlvesggglvqpggslrlscaasgytftn, seng, wesgie, ygmnwvrqapgkglewvgwintytgeptya, shimadzu, msdial, predicted, data, application, antibody, numbers, matching, chee, yonghai, zhan, internship, zhaoqi, independent, fragmentations, acid, tof, light, instrumentations, alterations, extracted, approach, skyline
Similar PDF
Data-independent Acquisition (DIA) Approach on Q-TOF Mass Spectrometry for In-depth Peptide Mapping of Monoclonal Antibodies
2020|Shimadzu|Posters
MP 117 A Data-independent Acquisition (DIA) Approach on Q-TOF Mass Spectrometry for In-depth Peptide Mapping of Monoclonal Antibodies Yonghai Lu1, Wesgie Oh Wen Qi2, Zhaoqi Zhan1 1, Shimadzu (Asia Pacific), Singapore. 2, National University of Singapore, Singapore. 1. Overview 4.…
Key words
peptide, peptidedial, dialbevacizumab, bevacizumabnovo, novosequencing, sequencingdia, diamabs, mabsdrugbank, drugbankproposed, proposedantibodies, antibodiesmapping, mappingmonoclonal, monoclonalnumbers, numbersindependent, independentalpapiek
Disulfide Bond Characterization of Monoclonal Antibody (mAb) Using Q-TOF Mass Spectrometer
2019|Shimadzu|Applications
Application News Biopharma / LCMS-9030 (Q-TOF) Disulfide Bond Characterization of Monoclonal Antibody (mAb) Using Q-TOF Mass Spectrometer No. AD-0214 Yonghai Lu and Zhaoqi Zhan Application Development & Support Centre, Shimadzu (Asia Pacific), Singapore ❑ Introduction Monoclonal antibody (mAb) is emerging…
Key words
disulfide, disulfidebond, bondnovo, novobiosimilar, biosimilarchain, chainpeptide, peptidemab, mabsequencing, sequencingreduced, reducednews, newslinkages, linkagesbevacizumab, bevacizumablcms, lcmsadduct, adductbonds
LC/MS/MS Peptide Mapping Comparison of Innovator and Biosimilars of Rituximab
2019|Agilent Technologies|Applications
Application Note Biotherapeutics and Biosimilars LC/MS/MS Peptide Mapping Comparison of Innovator and Biosimilars of Rituximab Author Suresh Babu C.V. Agilent Technologies, Inc. Abstract The development and manufacturing of biosimilars require comparability studies with innovator biotherapeutic products. This Application Note presents…
Key words
innovator, innovatorpeptide, peptidecounts, countschain, chainmapping, mappingbiosimilar, biosimilarcharge, chargeunmodified, unmodifiedptms, ptmsheavy, heavyassaymap, assaymapttppvldsdgsfflyskl, ttppvldsdgsfflysklmabs, mabsbiosimilars, biosimilarsbravo
Structure Characterization and Differentiation of Biosimilar and Reference Products Using Unique Combination of Complementary Fragmentation Mechanisms
2014|Thermo Fisher Scientific|Posters
Structure Characterization and Differentiation of Biosimilar and Reference Products Using Unique Combination of Complementary Fragmentation Mechanisms Zhiqi Hao,1 Chen Li, 2 Shiaw-Lin Wu, 2,3 David M. Horn1 and Jonathan Josephs1 1 Thermo Fisher Scientific, San Jose, CA; 2BioAnalytix Inc, Cambridge,…
Key words
tnk, tnkglycosylation, glycosylationggnm, ggnmglycoforms, glycoformspeptide, peptidebiosimilar, biosimilarggn, ggnhcd, hcdtpa, tpaspectrum, spectrumetd, etdnhnycr, nhnycrnycr, nycrsggn, sggnycr