Characterization of C-terminal and Disulfide Bond Peptides of Monoclonal Antibody (mAb) on Q-TOF Mass Spectrometer

Applications | 2019 | ShimadzuInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Industries
Pharma & Biopharma
Manufacturer
Shimadzu

Summary

Significance of the Topic


Monoclonal antibody therapeutics are critical for treating chronic diseases, and ensuring their structural integrity is essential for biosimilar quality control. Peptide mapping of C-terminal sequences and disulfide bond linkages provides insight into primary structure and post-translational modifications.

Objectives and Study Overview


This study aimed to characterize a bevacizumab biosimilar by mapping and sequencing its C-terminal and cysteine-containing peptides using a Shimadzu LCMS-9030 Q-TOF mass spectrometer. Key goals included detecting lysine variants, disulfide-linked peptides, and confirming sequence integrity.

Methods and Instrumentation


  • Sample preparation: Reduction with dithiothreitol, alkylation with iodoacetamide, tryptic digestion at 37 °C, quenching with trifluoroacetic acid and centrifugation.
  • LC conditions: Shim-pack GISS C18 column (250 × 4.6 mm, 5 μm), 0.1 % formic acid in water and acetonitrile, gradient from 0 % to 50 % B over 85 min, flow rate 0.3 mL/min, column temperature 40 °C.
  • MS settings: Heated electrospray ionization in positive mode, MS scan range m/z 250–2500, MS/MS fragmentation, nitrogen nebulizing and drying gases.

Main Results and Discussion


  • TIC and extract ion chromatograms enabled detection of fifteen cysteine-containing peptides and three C-terminal peptides with mass accuracy < 2 ppm.
  • Heavy chain C-terminal peptides exhibited lysine truncation, with the clipped form dominating (> 99 %) over the lysine-retained variant.
  • Carbamidomethyl modifications on cysteines were confirmed, and de novo sequencing of selected peptides showed comprehensive b- and y-ion coverage, validating sequence assignments.

Benefits and Practical Applications


The described workflow delivers a fast and reliable approach for monitoring critical quality attributes of mAb biosimilars. The EIC-based method with high mass accuracy simplifies peptide identification and supports routine QC environments.

Future Trends and Opportunities


Advancements may include automated data processing, deeper coverage of complex post-translational modifications, integration of ion mobility for conformational analysis, and machine-learning-driven de novo sequencing to further streamline biosimilar characterization.

Conclusion


The LCMS-9030 Q-TOF system effectively characterized C-terminal and disulfide bond-linked peptides of a bevacizumab biosimilar. The study confirms the instrument’s capability for accurate peptide mapping and sequence confirmation in biosimilar development.

Used Instrumentation


  • Shimadzu LCMS-9030 Q-TOF mass spectrometer
  • Shim-pack GISS C18 column, 5 μm, 250 × 4.6 mm
  • Heated ESI interface and nitrogen gas supplies

References


  • Dick LW Jr, Qiu D, Mahon D, Adamo M, Cheng K. C-terminal lysine variants in fully human monoclonal antibodies: Investigation of test methods and possible causes. Biotechnol Bioeng. 2008;100:1132-1143.
  • Protein Metrics. Byos software.
  • MacLean B, et al. Skyline: an open source document editor for creating and analyzing targeted proteomics experiments. Bioinformatics. 2010;26:966–968.
  • Shimadzu Application News AD-0176. Peptide Mapping of Monoclonal Antibody (mAb) Using Nexera Bio with Q-TOF Mass Spectrometer for Full Sequence Confirmation. 2019.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Characterization of Monoclonal Antibody Biosimilar through C-terminal and Disulfide Bond Peptides Sequencing Analysis on Q-TOF Mass Spectrometer
WP 039 Characterization of Monoclonal Antibody Biosimilar through C-terminal and Disulfide Bond Peptides Sequencing Analysis on Q-TOF Mass Spectrometer Udi Jumhawan and Zhaoqi Zhan Application Development & Support Centre, Shimadzu (Asia Pacific) Pte Ltd, 79 Science Park Drive, Singapore 1.…
Key words
terminal, terminalpeptides, peptidescysteine, cysteinesequencing, sequencingvyacevthqglssp, vyacevthqglsspvtk, vtkdisulfide, disulfidebiosimilar, biosimilarvyacevthqglsspvtk, vyacevthqglsspvtkhinge, hingebond, bonddtt, dttmapping, mappinglinked, linkedcontaining
Disulfide Bond Characterization of Monoclonal Antibody (mAb) Using Q-TOF Mass Spectrometer
Application News Biopharma / LCMS-9030 (Q-TOF) Disulfide Bond Characterization of Monoclonal Antibody (mAb) Using Q-TOF Mass Spectrometer No. AD-0214 Yonghai Lu and Zhaoqi Zhan Application Development & Support Centre, Shimadzu (Asia Pacific), Singapore ❑ Introduction Monoclonal antibody (mAb) is emerging…
Key words
disulfide, disulfidebond, bondnovo, novobiosimilar, biosimilarchain, chainpeptide, peptidemab, mabsequencing, sequencingreduced, reducednews, newslinkages, linkagesbevacizumab, bevacizumablcms, lcmsadduct, adductdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyicnv
Peptide Mapping of Monoclonal Antibody (mAb) Using Nexera Bio with Q-TOF Mass Spectrometer for Full Sequence Confirmation
Application News AD-0176 Biopharma / Nexera Bio & Q-TOF LCMS-9030 Peptide Mapping of Monoclonal Antibody (mAb) Using Nexera Bio with Q-TOF Mass Spectrometer for Full Sequence Confirmation Udi Jumhawan, Wan Tung Liw, Jie Xing and Zhaoqi Zhan Application Development &…
Key words
nexera, nexerapeak, peaktryptic, trypticbio, biobiosimilar, biosimilarbevacizumab, bevacizumabpeptide, peptideantibody, antibodyuhplc, uhplcdigests, digestsigg, iggmin, minnews, newsmapping, mappingbiosimilars
IMSC: Full Characterization of Heterogeneous Antibody Samples Under Denaturing and Native Conditions on a Hybrid Quadrupole-Orbitrap Mass Spectrometer
RES MS analysis of antibodies at the protein and peptide levels is critical during development and production of biopharmaceuticals. The compositions of current generation therapeutic proteins are often complex due to their heterogeneity caused by various modifications which are relevant…
Key words
abundance, abundancelys, lystrastuzumab, trastuzumabrelative, relativeinfliximab, infliximabdisulfide, disulfidenative, nativebevacizumab, bevacizumabzoom, zoomxtract, xtractslslspgkc, slslspgkcslslspg, slslspgchain, chainreduced, reducedintact
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike