Login
LabRulez
Registration
Settings
Filter
Filter
Password reset
Password reset

Peptide Mapping of Monoclonal Antibody (mAb) Using Nexera Bio with Q-TOF Mass Spectrometer for Full Sequence ConfirmationApplications | 2019 | ShimadzuInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Industries
Pharma & Biopharma
Manufacturer
Shimadzu
Key words
nexera, bio, biosimilar, peak, tryptic, peptide, bevacizumab, antibody, digests, uhplc, igg, news, min, mapping, biosimilars, day, tof, digest, dyfpepvtvswnsgaltsgvhtfpavlqssglyslssv, fsgsgsgtdftltisslqpedfatyycqqystvpwtfgq, monoclonal, mau, reliability, program, biosimilarity, slslspg, practicability, triply, chain, same, abc, internship, primary, characterization, mass, dtt, system, volume, application, shimadzu, injections, robust, doubly, her, gradient, bicarbonate, average, mobile, centrifuged, terminal

Peptide Mapping of Monoclonal Antibody (mAb) Using Nexera Bio with Q-TOF Mass Spectrometer for Full Sequence ConfirmationApplications | 2019 | ShimadzuInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Industries
Pharma & Biopharma
Manufacturer
Shimadzu
Key words
nexera, bio, biosimilar, peak, tryptic, peptide, bevacizumab, antibody, digests, uhplc, igg, news, min, mapping, biosimilars, day, tof, digest, dyfpepvtvswnsgaltsgvhtfpavlqssglyslssv, fsgsgsgtdftltisslqpedfatyycqqystvpwtfgq, monoclonal, mau, reliability, program, biosimilarity, slslspg, practicability, triply, chain, same, abc, internship, primary, characterization, mass, dtt, system, volume, application, shimadzu, injections, robust, doubly, her, gradient, bicarbonate, average, mobile, centrifuged, terminal

 

Related content

Fully Using Agilent High Efficiency Columns with LC/MS

Technical notes
| 2015 | Agilent Technologies
Instrumentation
Consumables, LC columns
Manufacturer
Agilent Technologies
Industries
---

Agilent PL-SP 260VS Sample Preparation System for Gel Permeation Chromatography

Technical notes
| 2015 | Agilent Technologies
Instrumentation
Sample Preparation, GPC/SEC
Manufacturer
Agilent Technologies
Industries
---

Effect of Molecular Weight on Sample Loading in Gel Permeation Chromatography

Technical notes
| 2015 | Agilent Technologies
Instrumentation
GPC/SEC
Manufacturer
Agilent Technologies
Industries
---
 

Related content

Fully Using Agilent High Efficiency Columns with LC/MS

Technical notes
| 2015 | Agilent Technologies
Instrumentation
Consumables, LC columns
Manufacturer
Agilent Technologies
Industries
---

Agilent PL-SP 260VS Sample Preparation System for Gel Permeation Chromatography

Technical notes
| 2015 | Agilent Technologies
Instrumentation
Sample Preparation, GPC/SEC
Manufacturer
Agilent Technologies
Industries
---

Effect of Molecular Weight on Sample Loading in Gel Permeation Chromatography

Technical notes
| 2015 | Agilent Technologies
Instrumentation
GPC/SEC
Manufacturer
Agilent Technologies
Industries
---
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use

LabRulez s.r.o., all rights reserved.