Peptide Mapping of Monoclonal Antibody (mAb) Using LCMS-9030 (Q-TOF) Mass Spectrometerwith a Shim-pack GISS-HP Column
Applications | 2019 | ShimadzuInstrumentation
Monoclonal antibody (mAb) biotherapeutics represent a rapidly expanding class of drugs, with peptide mapping serving as a cornerstone for confirming primary structure and ensuring product quality. Fast and reliable peptide mapping workflows are crucial for biosimilar development, regulatory compliance, and routine quality control.
This study aimed to optimize a peptide mapping protocol for a bevacizumab biosimilar, reducing analysis time while maintaining comprehensive sequence coverage. Building on previous workflows requiring 120 minutes per run, the authors targeted a method under 45 minutes that still delivers accurate mass identification and full sequence confirmation.
The workflow comprises the following key steps:
Instrumentation:
The optimized workflow delivered the following performance:
The rapid, high-resolution peptide mapping method supports accelerated biosimilar characterization and robust quality control. It enables full primary sequence confirmation in less than one hour, improving laboratory throughput and confidence in product integrity.
Emerging directions include:
The optimized 45-minute peptide mapping protocol on the Shimadzu LCMS-9030 Q-TOF provides high reproducibility, full sequence coverage, and precise mass accuracy. It represents a valuable tool for routine mAb characterization in biopharmaceutical research and quality control.
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesClinical Research
ManufacturerShimadzu
Summary
Importance of the Topic
Monoclonal antibody (mAb) biotherapeutics represent a rapidly expanding class of drugs, with peptide mapping serving as a cornerstone for confirming primary structure and ensuring product quality. Fast and reliable peptide mapping workflows are crucial for biosimilar development, regulatory compliance, and routine quality control.
Objectives and Study Overview
This study aimed to optimize a peptide mapping protocol for a bevacizumab biosimilar, reducing analysis time while maintaining comprehensive sequence coverage. Building on previous workflows requiring 120 minutes per run, the authors targeted a method under 45 minutes that still delivers accurate mass identification and full sequence confirmation.
Methodology and Instrumentation
The workflow comprises the following key steps:
- Sample preparation: Denaturation and reduction of 5 mg/mL bevacizumab biosimilar in Tris-HCl buffer, alkylation with iodoacetamide, and overnight trypsin digestion.
- Chromatography: Separation on a Shim-pack GISS-HP C18 column (3 µm, 150 × 3.0 mm) using mobile phases of 0.1% formic acid/0.01% TFA in water (A) and acetonitrile (B), at 0.5 mL/min with a 45-minute gradient.
- Mass spectrometry: Analysis on a Shimadzu LCMS-9030 Q-TOF with heated ESI in positive mode, scanning m/z 100–2000.
Instrumentation:
- Nexera X2 UHPLC system
- Shim-pack GISS-HP column, 3 µm particle size
- Shimadzu LCMS-9030 Q-TOF mass spectrometer
Main Results and Discussion
The optimized workflow delivered the following performance:
- Run time shortened from 120 to 45 minutes without loss of data quality.
- Excellent repeatability over six injections: retention time RSD <0.1%, peak area RSD <3%.
- Identification of 19 light-chain and 42 heavy-chain tryptic peptides, achieving 100% sequence coverage for the light chain and 99.8% for the heavy chain.
- Accurate mass measurements within 3 ppm of theoretical values.
- Detection of expected missed cleavages at KR, RR, and KK sites, and observation of C-terminal lysine truncation in heavy chain peptides.
Benefits and Practical Applications
The rapid, high-resolution peptide mapping method supports accelerated biosimilar characterization and robust quality control. It enables full primary sequence confirmation in less than one hour, improving laboratory throughput and confidence in product integrity.
Future Trends and Potential Applications
Emerging directions include:
- Integration with automated sample preparation platforms for higher throughput.
- Application of advanced data analysis tools and cloud-based workflows to speed up sequence assignment.
- Extension to other biotherapeutics, including multi-specific antibodies and fusion proteins.
- Combining peptide mapping with sub-unit analysis for comprehensive structural characterization.
Conclusion
The optimized 45-minute peptide mapping protocol on the Shimadzu LCMS-9030 Q-TOF provides high reproducibility, full sequence coverage, and precise mass accuracy. It represents a valuable tool for routine mAb characterization in biopharmaceutical research and quality control.
References
- Shimadzu (Asia Pacific), “Peptide Mapping of Monoclonal Antibody (mAb) Using Nexera Bio with Q-TOF Mass Spectrometer for Full Sequence Confirmation”, Application News No. AD-0176, 2018.
- Skyline software, MacCoss Lab, University of Washington.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Peptide Mapping of Monoclonal Antibody (mAb) Using Nexera Bio with Q-TOF Mass Spectrometer for Full Sequence Confirmation
2019|Shimadzu|Applications
Application News AD-0176 Biopharma / Nexera Bio & Q-TOF LCMS-9030 Peptide Mapping of Monoclonal Antibody (mAb) Using Nexera Bio with Q-TOF Mass Spectrometer for Full Sequence Confirmation Udi Jumhawan, Wan Tung Liw, Jie Xing and Zhaoqi Zhan Application Development &…
Key words
nexera, nexerapeak, peaktryptic, trypticbio, biobiosimilar, biosimilarbevacizumab, bevacizumabpeptide, peptideantibody, antibodyuhplc, uhplcdigests, digestsigg, iggmin, minnews, newsmapping, mappingbiosimilars
Disulfide Bond Characterization of Monoclonal Antibody (mAb) Using Q-TOF Mass Spectrometer
2019|Shimadzu|Applications
Application News Biopharma / LCMS-9030 (Q-TOF) Disulfide Bond Characterization of Monoclonal Antibody (mAb) Using Q-TOF Mass Spectrometer No. AD-0214 Yonghai Lu and Zhaoqi Zhan Application Development & Support Centre, Shimadzu (Asia Pacific), Singapore ❑ Introduction Monoclonal antibody (mAb) is emerging…
Key words
disulfide, disulfidebond, bondnovo, novobiosimilar, biosimilarchain, chainpeptide, peptidemab, mabsequencing, sequencingreduced, reducednews, newsbevacizumab, bevacizumablinkages, linkageslcms, lcmsadduct, adductdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyicnv
In-depth Peptide Mapping of Monoclonal Antibody (mAb) by A de novo Peptide Sequencing Method on Q-TOF Mass Spectrometer with Data-independent Acquisition
2019|Shimadzu|Applications
Application News No. AD-0217 Biopharma / LCMS-9030 (Q-TOF) In-depth Peptide Mapping of Monoclonal Antibody (mAb) by A de novo Peptide Sequencing Method on Q-TOF Mass Spectrometer with Data-independent Acquisition Yonghai Lu and Zhaoqi Zhan Application Development & Support Centre, Shimadzu…
Key words
peptide, peptidedia, diamab, mabnovo, novomapping, mappingbevacizumab, bevacizumabchain, chainsequencing, sequencingalpapiek, alpapiekpeptides, peptidestryptic, trypticnews, newsdial, dialmonoclonal, monoclonalheavy
Data-independent Acquisition (DIA) Approach on Q-TOF Mass Spectrometry for In-depth Peptide Mapping of Monoclonal Antibodies
2020|Shimadzu|Posters
MP 117 A Data-independent Acquisition (DIA) Approach on Q-TOF Mass Spectrometry for In-depth Peptide Mapping of Monoclonal Antibodies Yonghai Lu1, Wesgie Oh Wen Qi2, Zhaoqi Zhan1 1, Shimadzu (Asia Pacific), Singapore. 2, National University of Singapore, Singapore. 1. Overview 4.…
Key words
peptide, peptidedial, dialbevacizumab, bevacizumabnovo, novosequencing, sequencingdia, diamabs, mabsdrugbank, drugbankproposed, proposedantibodies, antibodiesmonoclonal, monoclonalmapping, mappingnumbers, numbersindependent, independentalpapiek