MSn Analyses for Tryptophan-Conjugated ADC Mimic by Miniature MALDI Digital Ion Trap Mass Spectrometer (MALDI-DIT-MS)
Posters | 2019 | ShimadzuInstrumentation
MALDI, LC/MS, LC/IT
IndustriesPharma & Biopharma
ManufacturerShimadzu
Key wordsmaldi, dit, tryptophan, miniature, mimic, conjugated, adc, msn, digital, abno, fluorescein, trap, analyses, spectrometer, unmodified, ion, backbone, modified, peptide, mass, nistmab, chain, seki, compact, superimpose, antibodies, acoh, ions, side, naked, sequence, artificially, internally, desalted, attempted, detected, appeared, molecular, respectively, value, digests, zoom, suggests, bound, same, derivatized, tryptic, only, focusing, modification
Similar PDF
Analysis of Modification Site of Chemically Modified Antibody Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer 
2019|Shimadzu|Applications
LAAN-A-TM-E069 Application News No. B99 MALDI Mass Spectrometry Analysis of Modification Site of Chemically Modified Antibody Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer Antibody drug conjugates (ADC), which appeared in the 2000s, are a new class of anti-cancer…
Key words
antibody, antibodyabno, abnounmodified, unmodifiedfluorescein, fluoresceinint, intmolecule, moleculebackbone, backbonemsn, msngpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv, gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssviavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhyt, iavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytpslkdrltiskdtsknqvvlkvtnmdpadtatyycardmifnfyfdvwgqgttvtvssastk, pslkdrltiskdtsknqvvlkvtnmdpadtatyycardmifnfyfdvwgqgttvtvssastkqkslslspgk, qkslslspgkqvtlresgpalvkptqtltltctfsgfslstagmsvgwirqppgkalewladiwwddkkhyn, qvtlresgpalvkptqtltltctfsgfslstagmsvgwirqppgkalewladiwwddkkhyntlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqd, tlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcpapellggpsvflfppkpkd
The Development of Miniature MALDI Digital Ion Trap Mass Spectrometer
2019|Shimadzu|Posters
PO-CON1890E The Development of Miniature MALDI Digital Ion Trap Mass Spectrometer ASMS 2019 TP- 448 Kosuke Hosoi1, Masaji Furuta1, Hideharu Shichi1, Shosei Yamauchi1, Kiyoshi Watanabe1, Makoto Hazama1, Kei Kodera1, Shinichi Iwamoto1, Koichi Tanaka1 1 Shimadzu Corporation. 1, Nishinokyo-Kuwabaracho Nakagyo-ku, Kyoto…
Key words
miniature, miniaturemaldi, maldidigital, digitalwaveform, waveformdit, dittrap, trapion, ionspectrometer, spectrometerrectangular, rectangulardawi, dawidevelopment, developmentpsu, psumass, masslaser, laserprecursor
Analysis of Glycopeptides Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer
2019|Shimadzu|Applications
LAAN-A-TM-E070 Application News No. B100 MALDI Mass Spectrometer Analysis of Glycopeptides Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer Glycans, which are one post-translational modification of proteins, are molecules with high structural heterogeneity which are formed by complex bonding…
Key words
eeqynstyr, eeqynstyrglycopeptides, glycopeptidesglycan, glycanglycopeptide, glycopeptidemaldi, maldibinding, bindingspectrometer, spectrometersignals, signalsantibody, antibodycommercial, commercialglycoprotein, glycoproteinwave, wavebonding, bondingcompact, compactsites
Analysis of N-Linked Glycan using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer: Structural Analysis and Identification of Sialyl Linkage Isomers
2019|Shimadzu|Applications
LAAN-A-TM-E071 Application News MALDI-TOF Mass Spectrometry Analysis of N-Linked Glycan using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer: Structural No. B101 Analysis and Identification of Sialyl Linkage Isomers N-linked glycosylation to proteins plays an important role in various biological…
Key words
sialic, sialiclinkage, linkagealkylamidation, alkylamidationsalsa, salsaacid, acidderivative, derivativetypes, typesmaldi, maldiglycan, glycanlinked, linkedsialyl, sialylnonreducing, nonreducingneutralizes, neutralizesstructural, structuralterminals