MSn Analyses for Tryptophan-Conjugated ADC Mimic by Miniature MALDI Digital Ion Trap Mass Spectrometer (MALDI-DIT-MS)
Posters | 2019 | ShimadzuInstrumentation
The identification of conjugation sites on antibody–drug conjugates (ADCs) is essential for evaluating their structural homogeneity, stability, and therapeutic efficacy. Mapping modification locations at the amino-acid level supports rigorous quality control in biopharmaceutical development.
This study produced an ADC mimic by attaching methyl fluorescein-ABNO to tryptophan residues on a humanized IgGκ standard antibody (NISTmAb). It then applied MSn analysis on a compact MALDI digital ion trap mass spectrometer (MALDImini-1) to pinpoint the modification sites.
MALDImini-1 miniature MALDI digital ion trap mass spectrometer configured for MSn experiments with DHB matrix support.
MS analysis revealed four ions exclusive to the modified antibody, notably at m/z 2416.9 and 2560.9. Subsequent MS/MS and MS3 fragmentation produced backbone ions at m/z 1677.7 and 1808.0, matching spectra from the unmodified control. Mascot MS/MS searches identified these peptides as heavy-chain regions 278–291 (FNWYVDGVEVHNAK) and 305–320 (VVSVLTVLHQDWLNGK), confirming conjugation at the tryptophan side chains.
Future workflows may integrate MALDI-DIT-MS with automated sample handling and advanced bioinformatics for high-throughput ADC screening. Extension of this approach to other amino-acid targets or payload chemistries can broaden its applicability in next-generation bioconjugate characterization.
The MALDImini-1 digital ion trap platform demonstrated effective localization of tryptophan-based conjugation sites in an ADC mimic, underscoring its potential as a powerful tool for detailed quality assessment of biotherapeutics.
[1] Seki Y. et al. J. Am. Chem. Soc. 2016, 138, 10798–10801.
MALDI, LC/MS, LC/IT
IndustriesPharma & Biopharma
ManufacturerShimadzu
Summary
Significance of the topic
The identification of conjugation sites on antibody–drug conjugates (ADCs) is essential for evaluating their structural homogeneity, stability, and therapeutic efficacy. Mapping modification locations at the amino-acid level supports rigorous quality control in biopharmaceutical development.
Objectives and overview
This study produced an ADC mimic by attaching methyl fluorescein-ABNO to tryptophan residues on a humanized IgGκ standard antibody (NISTmAb). It then applied MSn analysis on a compact MALDI digital ion trap mass spectrometer (MALDImini-1) to pinpoint the modification sites.
Methodology and instrumentacion
- Enzymatic digestion: Both modified and unmodified NISTmAb samples were subjected to trypsin digestion followed by C18 ZipTip® desalting.
- MALDI preparation: Peptide mixtures were co-crystallized with 2,5-dihydroxybenzoic acid (DHB) matrix on a stainless-steel target.
Used Instrumentation
MALDImini-1 miniature MALDI digital ion trap mass spectrometer configured for MSn experiments with DHB matrix support.
Main results and discussion
MS analysis revealed four ions exclusive to the modified antibody, notably at m/z 2416.9 and 2560.9. Subsequent MS/MS and MS3 fragmentation produced backbone ions at m/z 1677.7 and 1808.0, matching spectra from the unmodified control. Mascot MS/MS searches identified these peptides as heavy-chain regions 278–291 (FNWYVDGVEVHNAK) and 305–320 (VVSVLTVLHQDWLNGK), confirming conjugation at the tryptophan side chains.
Benefits and practical applications
- Enables rapid, site-specific localization of tryptophan modifications in ADCs without lengthy chromatographic separation.
- Compact system footprint suitable for routine QC and process monitoring in R&D laboratories.
- MSn capability provides detailed structural information essential for regulatory submissions.
Future trends and opportunities
Future workflows may integrate MALDI-DIT-MS with automated sample handling and advanced bioinformatics for high-throughput ADC screening. Extension of this approach to other amino-acid targets or payload chemistries can broaden its applicability in next-generation bioconjugate characterization.
Conclusion
The MALDImini-1 digital ion trap platform demonstrated effective localization of tryptophan-based conjugation sites in an ADC mimic, underscoring its potential as a powerful tool for detailed quality assessment of biotherapeutics.
Reference
[1] Seki Y. et al. J. Am. Chem. Soc. 2016, 138, 10798–10801.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Analysis of Modification Site of Chemically Modified Antibody Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer 
2019|Shimadzu|Applications
LAAN-A-TM-E069 Application News No. B99 MALDI Mass Spectrometry Analysis of Modification Site of Chemically Modified Antibody Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer Antibody drug conjugates (ADC), which appeared in the 2000s, are a new class of anti-cancer…
Key words
antibody, antibodyabno, abnounmodified, unmodifiedfluorescein, fluoresceinint, intmolecule, moleculebackbone, backbonemsn, msngpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv, gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssviavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhyt, iavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytpslkdrltiskdtsknqvvlkvtnmdpadtatyycardmifnfyfdvwgqgttvtvssastk, pslkdrltiskdtsknqvvlkvtnmdpadtatyycardmifnfyfdvwgqgttvtvssastkqkslslspgk, qkslslspgkqvtlresgpalvkptqtltltctfsgfslstagmsvgwirqppgkalewladiwwddkkhyn, qvtlresgpalvkptqtltltctfsgfslstagmsvgwirqppgkalewladiwwddkkhyntlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqd, tlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcpapellggpsvflfppkpkd
The Development of Miniature MALDI Digital Ion Trap Mass Spectrometer
2019|Shimadzu|Posters
PO-CON1890E The Development of Miniature MALDI Digital Ion Trap Mass Spectrometer ASMS 2019 TP- 448 Kosuke Hosoi1, Masaji Furuta1, Hideharu Shichi1, Shosei Yamauchi1, Kiyoshi Watanabe1, Makoto Hazama1, Kei Kodera1, Shinichi Iwamoto1, Koichi Tanaka1 1 Shimadzu Corporation. 1, Nishinokyo-Kuwabaracho Nakagyo-ku, Kyoto…
Key words
miniature, miniaturemaldi, maldidigital, digitalwaveform, waveformdit, dittrap, trapion, ionspectrometer, spectrometerdawi, dawirectangular, rectangularpsu, psudevelopment, developmentmass, massprecursor, precursorlaser
Analysis of Glycopeptides Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer
2019|Shimadzu|Applications
LAAN-A-TM-E070 Application News No. B100 MALDI Mass Spectrometer Analysis of Glycopeptides Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer Glycans, which are one post-translational modification of proteins, are molecules with high structural heterogeneity which are formed by complex bonding…
Key words
eeqynstyr, eeqynstyrglycopeptides, glycopeptidesglycan, glycanglycopeptide, glycopeptidemaldi, maldibinding, bindingspectrometer, spectrometersignals, signalsantibody, antibodycommercial, commercialglycoprotein, glycoproteinwave, wavebonding, bondingcompact, compactsites
Analysis of N-Linked Glycan using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer: Structural Analysis and Identification of Sialyl Linkage Isomers
2019|Shimadzu|Applications
LAAN-A-TM-E071 Application News MALDI-TOF Mass Spectrometry Analysis of N-Linked Glycan using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer: Structural No. B101 Analysis and Identification of Sialyl Linkage Isomers N-linked glycosylation to proteins plays an important role in various biological…
Key words
sialic, sialiclinkage, linkagealkylamidation, alkylamidationsalsa, salsaacid, acidderivative, derivativeglycan, glycantypes, typesmaldi, maldisialyl, sialyllinked, linkednonreducing, nonreducingstructural, structuralneutralizes, neutralizesterminals