Analysis of Glycopeptides Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer
Applications | 2019 | ShimadzuInstrumentation
MALDI, LC/MS, LC/IT
IndustriesPharma & Biopharma
ManufacturerShimadzu
Key wordseeqynstyr, glycopeptides, glycan, glycopeptide, maldi, binding, spectrometer, signals, antibody, commercial, glycoprotein, wave, bonding, compact, sites, coincide, sine, dit, illness, site, news, mass, rectangular, assumed, phenomenon, coil, possible, backbone, recovered, msn, confirming, modulation, obtaining, washing, absence, digital, rather, article, without, from, understand, generator, spectrometers, monoclonal, structures, utilizing, reports, although, depending, removed
Similar PDF
Rapid Identification of Bacillus Spores by MALDImini-1 Compact MALDI Digital Ion Trap (DIT) Mass Spectrometer
2020|Shimadzu|Applications
Application News No. B112 MALDI-TOF Mass Spectroscopy Rapid Identification of Bacillus Spores by MALDImini™-1 Compact MALDI Digital Ion Trap (DIT) Mass Spectrometer Introduction Identification of bacterial species is necessary for the determination of the appropriate antibacterial drugs for pathogenic…
Key words
spore, sporemaldi, maldispores, sporesbeads, beadsidentification, identificationtrypsin, trypsinspecies, speciesmicrobial, microbialbacteria, bacteriabacterial, bacterialproteins, proteinsquick, quicktryptic, trypticdigital, digitalpostsource
Rapid Identification of Bacillus Spores by MALDImini™-1 Compact MALDI Digital Ion Trap (DIT) Mass Spectrometer
2020|Shimadzu|Applications
Application News No. B112 MALDI-TOF Mass Spectroscopy Rapid Identification of Bacillus Spores by MALDImini™-1 Compact MALDI Digital Ion Trap (DIT) Mass Spectrometer Introduction Identification of bacterial species is necessary for the determination of the appropriate antibacterial drugs for pathogenic…
Key words
spore, sporemaldi, maldispores, sporesbeads, beadsidentification, identificationtrypsin, trypsinspecies, speciesmicrobial, microbialbacteria, bacteriabacterial, bacterialproteins, proteinsquick, quicktryptic, trypticpostsource, postsourcedigital
Analysis of Modification Site of Chemically Modified Antibody Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer
2019|Shimadzu|Applications
LAAN-A-TM-E069 Application News No. B99 MALDI Mass Spectrometry Analysis of Modification Site of Chemically Modified Antibody Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer Antibody drug conjugates (ADC), which appeared in the 2000s, are a new class of anti-cancer…
Key words
antibody, antibodyabno, abnounmodified, unmodifiedfluorescein, fluoresceinint, intmolecule, moleculebackbone, backbonemsn, msngpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv, gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssviavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhyt, iavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytpslkdrltiskdtsknqvvlkvtnmdpadtatyycardmifnfyfdvwgqgttvtvssastk, pslkdrltiskdtsknqvvlkvtnmdpadtatyycardmifnfyfdvwgqgttvtvssastkqkslslspgk, qkslslspgkqvtlresgpalvkptqtltltctfsgfslstagmsvgwirqppgkalewladiwwddkkhyn, qvtlresgpalvkptqtltltctfsgfslstagmsvgwirqppgkalewladiwwddkkhyntlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqd, tlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcpapellggpsvflfppkpkd
Analysis of N-Linked Glycan using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer: Structural Analysis and Identification of Sialyl Linkage Isomers
2019|Shimadzu|Applications
LAAN-A-TM-E071 Application News MALDI-TOF Mass Spectrometry Analysis of N-Linked Glycan using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer: Structural No. B101 Analysis and Identification of Sialyl Linkage Isomers N-linked glycosylation to proteins plays an important role in various biological…
Key words
sialic, sialiclinkage, linkagealkylamidation, alkylamidationsalsa, salsaacid, acidderivative, derivativetypes, typesmaldi, maldiglycan, glycanlinked, linkedsialyl, sialylnonreducing, nonreducingstructural, structuralneutralizes, neutralizesterminals