Rapid Identification of Bacillus Spores by MALDImini™-1 Compact MALDI Digital Ion Trap (DIT) Mass Spectrometer
Applications | 2020 | ShimadzuInstrumentation
Rapid identification of microbial species underpins effective clinical treatment, food quality control, and biosecurity measures.
The emergence of compact mass spectrometers allows extension of advanced proteomic workflows outside conventional laboratories.
This work demonstrates a streamlined approach for spore-forming Bacillus identification using on-plate proteolysis and MALDI-based tandem MS.
The study focuses on Bacillus subtilis spores as a model system to validate rapid species-level discrimination.
An immobilized trypsin bead protocol enabled 30-minute on-plate digestion of spore proteins.
Proteolytic peptides were co-crystallized with α-cyano-4-hydroxycinnamic acid matrix.
MS and MS/MS analyses were conducted on Shimadzu’s MALDImini-1 compact digital ion trap mass spectrometer.
Several tryptic peptides from spore proteins were detected in the MS spectrum, notably a peak at m/z 1879.
MS/MS fragmentation of this ion followed by Mascot database search identified a small acid-soluble spore protein unique to B. subtilis.
BLAST analysis confirmed sequence specificity, differentiating B. subtilis from B. cereus and B. anthracis.
The compact MALDI-DIT system provided sufficient mass accuracy and resolution for confident peptide assignment.
The workflow achieves species-level identification within one hour, compared to multi-hour or multi-day protocols.
The small footprint of MALDImini-1 allows deployment in field or point-of-care settings.
Rapid spore analysis has implications for food safety testing, clinical diagnostics, and biodefense screening.
Integration with automated sample handling could further reduce hands-on time.
Expansion of peptide marker libraries will enhance identification of mixed cultures and rare species.
Adaptation to other post-translational modification analyses may broaden utility in proteomics and biomarker discovery.
The presented method combines on-plate tryptic digestion and compact MALDI-DIT mass spectrometry for rapid, reliable spore identification.
This platform offers a versatile solution for decentralized microbial analysis where speed and portability are essential.
MALDI, LC/MS, LC/IT
IndustriesClinical Research
ManufacturerShimadzu
Summary
Importance of Topic
Rapid identification of microbial species underpins effective clinical treatment, food quality control, and biosecurity measures.
The emergence of compact mass spectrometers allows extension of advanced proteomic workflows outside conventional laboratories.
Aims and Study Overview
This work demonstrates a streamlined approach for spore-forming Bacillus identification using on-plate proteolysis and MALDI-based tandem MS.
The study focuses on Bacillus subtilis spores as a model system to validate rapid species-level discrimination.
Methodology and Instrumentation
An immobilized trypsin bead protocol enabled 30-minute on-plate digestion of spore proteins.
Proteolytic peptides were co-crystallized with α-cyano-4-hydroxycinnamic acid matrix.
MS and MS/MS analyses were conducted on Shimadzu’s MALDImini-1 compact digital ion trap mass spectrometer.
- MALDImini-1 DIT mass spectrometer with MS/MS and MS3 capability
- 10% trifluoroacetic acid for protein extraction
- ProteoChem trypsin beads for rapid digestion
- α-Cyano-4-hydroxycinnamic acid matrix solution
Main Results and Discussion
Several tryptic peptides from spore proteins were detected in the MS spectrum, notably a peak at m/z 1879.
MS/MS fragmentation of this ion followed by Mascot database search identified a small acid-soluble spore protein unique to B. subtilis.
BLAST analysis confirmed sequence specificity, differentiating B. subtilis from B. cereus and B. anthracis.
The compact MALDI-DIT system provided sufficient mass accuracy and resolution for confident peptide assignment.
Benefits and Practical Applications
The workflow achieves species-level identification within one hour, compared to multi-hour or multi-day protocols.
The small footprint of MALDImini-1 allows deployment in field or point-of-care settings.
Rapid spore analysis has implications for food safety testing, clinical diagnostics, and biodefense screening.
Future Trends and Potential Applications
Integration with automated sample handling could further reduce hands-on time.
Expansion of peptide marker libraries will enhance identification of mixed cultures and rare species.
Adaptation to other post-translational modification analyses may broaden utility in proteomics and biomarker discovery.
Conclusion
The presented method combines on-plate tryptic digestion and compact MALDI-DIT mass spectrometry for rapid, reliable spore identification.
This platform offers a versatile solution for decentralized microbial analysis where speed and portability are essential.
References
- B. Warscheid and C. Fenselau (2003). Characterization of Bacillus Spore Species and Their Mixtures Using Postsource Decay with a Curved-Field Reflectron. Anal. Chem. 75:5618-5627.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Rapid Identification of Bacillus Spores by MALDImini-1 Compact MALDI Digital Ion Trap (DIT) Mass Spectrometer
2020|Shimadzu|Applications
Application News No. B112 MALDI-TOF Mass Spectroscopy Rapid Identification of Bacillus Spores by MALDImini™-1 Compact MALDI Digital Ion Trap (DIT) Mass Spectrometer Introduction Identification of bacterial species is necessary for the determination of the appropriate antibacterial drugs for pathogenic…
Key words
spore, sporemaldi, maldispores, sporesbeads, beadsidentification, identificationtrypsin, trypsinspecies, speciesmicrobial, microbialbacteria, bacteriabacterial, bacterialproteins, proteinsquick, quicktryptic, trypticpostsource, postsourcedigital
Analysis of Modification Site of Chemically Modified Antibody Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer 
2019|Shimadzu|Applications
LAAN-A-TM-E069 Application News No. B99 MALDI Mass Spectrometry Analysis of Modification Site of Chemically Modified Antibody Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer Antibody drug conjugates (ADC), which appeared in the 2000s, are a new class of anti-cancer…
Key words
antibody, antibodyabno, abnounmodified, unmodifiedfluorescein, fluoresceinint, intmolecule, moleculemsn, msnbackbone, backbonegpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv, gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssviavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhyt, iavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytpslkdrltiskdtsknqvvlkvtnmdpadtatyycardmifnfyfdvwgqgttvtvssastk, pslkdrltiskdtsknqvvlkvtnmdpadtatyycardmifnfyfdvwgqgttvtvssastkqkslslspgk, qkslslspgkqvtlresgpalvkptqtltltctfsgfslstagmsvgwirqppgkalewladiwwddkkhyn, qvtlresgpalvkptqtltltctfsgfslstagmsvgwirqppgkalewladiwwddkkhyntlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqd, tlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcpapellggpsvflfppkpkd
Analysis of Glycopeptides Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer
2019|Shimadzu|Applications
LAAN-A-TM-E070 Application News No. B100 MALDI Mass Spectrometer Analysis of Glycopeptides Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer Glycans, which are one post-translational modification of proteins, are molecules with high structural heterogeneity which are formed by complex bonding…
Key words
eeqynstyr, eeqynstyrglycopeptides, glycopeptidesglycan, glycanglycopeptide, glycopeptidemaldi, maldibinding, bindingspectrometer, spectrometersignals, signalsantibody, antibodycommercial, commercialglycoprotein, glycoproteinwave, wavebonding, bondingcompact, compactsites
Performance Evaluation of Microbial Identification Using a Benchtop MALDI-TOF MS
2026|Shimadzu|Applications
Matrix-Assisted Laser Desorption/Ionization Time-of-Flight Mass Spectrometer MALDI-TOF MS Microbial Identification Software Application News Performance Evaluation of Microbial Identification Using a Benchtop MALDI-TOF MS Yumi Unno, Tomonori Oshikawa, Kanae Teramoto User Benefits Microbial species can be identified with high accuracy…
Key words
very, verybacillus, bacillushigh, highstaphylococcus, staphylococcusacinetobacter, acinetobactermicrococcus, micrococcuslactobacillus, lactobacillusmaldi, maldimicrobialtrack, microbialtrackmicrobial, microbiallactiplantibacillus, lactiplantibacilluslatilactobacillus, latilactobacilluslacticaseibacillus, lacticaseibacillusidentification, identificationlapidilactobacillus