Rapid Identification of Bacillus Spores by MALDImini-1 Compact MALDI Digital Ion Trap (DIT) Mass Spectrometer

Applications | 2020 | ShimadzuInstrumentation
MALDI, LC/MS, LC/IT
Industries
Clinical Research
Manufacturer
Shimadzu

Summary

Importance of the Topic


Plate-based proteolytic profiling using MALDI-TOF MS has become essential for rapid and accurate identification of microbial species. Conventional MALDI-TOF workflows struggle to analyze spore-forming bacteria and complex mixtures, presenting challenges in diagnostics, food safety, and biodefense. Developing accelerated methods for spore detection addresses critical needs in clinical microbiology and biosecurity.

Goals and Study Overview


We aimed to devise a streamlined approach for identifying Bacillus spores using on-target enzymatic digestion followed by MALDI-MS/MS. The study focused on Bacillus subtilis spores as a model, evaluating a compact MALDI-DIT instrument for rapid proteomic analysis.

Methodology and Instrumentation


Sample Preparation Workflow:
  • Spore formation: Cultivation of Bacillus subtilis subsp. subtilis NBRC 13719T on nutrient agar at 30 °C for a minimum of one week; confirmation via microscopy.
  • Cell lysis and protein extraction: Application of bacterial smear on MALDI target; addition of 10% trifluoroacetic acid; drying.
  • Immobilized trypsin digestion: Addition of trypsin beads; incubation at 37 °C for 30 minutes under humid conditions.
  • Matrix application: Overlay of α-cyano-4-hydroxycinnamic acid solution; drying.
  • Mass spectrometry: Acquisition of MS and MS/MS spectra using the MALDImini-1 compact MALDI-DIT.

Instrumentation Used:
  • MALDImini-1 compact MALDI-DIT mass spectrometer
  • Trypsin-immobilized beads (ProteoChem)
  • α-Cyano-4-hydroxycinnamic acid matrix solution
  • 10% trifluoroacetic acid

Main Results and Discussion


  • MS spectra of tryptic digests revealed multiple peptide peaks; m/z 1879 was selected for MS/MS fragmentation.
  • Database search (Mascot) identified the peptide as a small acid-soluble spore protein (SASP) from B. subtilis.
  • BLAST verification confirmed sequence uniqueness to B. subtilis, distinguishing it from B. anthracis and B. cereus.
  • These findings validate the feasibility of rapid on-plate digestion coupled with MALDI-MS/MS for species-level spore identification.

Benefits and Practical Applications


  • Substantially reduced digestion time (30 minutes) compared to conventional overnight protocols.
  • Compact instrument design enables near-sample analysis, enhancing workflow efficiency in constrained laboratory spaces.
  • Applicable to rapid pathogen identification in clinical, food safety, and biodefense scenarios.

Future Trends and Potential Applications


  • Extension of workflow to mixed microbial communities and other spore-forming genera.
  • Integration with automated sample preparation platforms for higher throughput.
  • Development of robust reference libraries for comprehensive MS/MS-based microbial identification.

Conclusion


The presented approach combines on-plate proteolysis with compact MALDI-DIT MS/MS to rapidly and specifically identify Bacillus spores. The use of immobilized trypsin and a bench-top DIT system achieves fast turnaround, offering a versatile platform for microbial diagnostics in limited-space environments.

References


  • B. Warscheid and C. Fenselau (2003) Characterization of Bacillus Spore Species and Their Mixtures Using Postsource Decay with a Curved-Field Reflectron. Analytical Chemistry 75:5618–5627.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Rapid Identification of Bacillus Spores by MALDImini™-1 Compact MALDI Digital Ion Trap (DIT) Mass Spectrometer
Application News No. B112 MALDI-TOF Mass Spectroscopy Rapid Identification of Bacillus Spores by MALDImini™-1 Compact MALDI Digital Ion Trap (DIT) Mass Spectrometer „ Introduction Identification of bacterial species is necessary for the determination of the appropriate antibacterial drugs for pathogenic…
Key words
spore, sporemaldi, maldispores, sporesbeads, beadsidentification, identificationtrypsin, trypsinspecies, speciesmicrobial, microbialbacteria, bacteriaproteins, proteinsbacterial, bacterialquick, quicktryptic, trypticpostsource, postsourcedigital
Analysis of Modification Site of Chemically Modified Antibody Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer
LAAN-A-TM-E069 Application News No. B99 MALDI Mass Spectrometry Analysis of Modification Site of Chemically Modified Antibody Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer Antibody drug conjugates (ADC), which appeared in the 2000s, are a new class of anti-cancer…
Key words
antibody, antibodyabno, abnounmodified, unmodifiedfluorescein, fluoresceinint, intmolecule, moleculemsn, msnbackbone, backbonegpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv, gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssviavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhyt, iavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytpslkdrltiskdtsknqvvlkvtnmdpadtatyycardmifnfyfdvwgqgttvtvssastk, pslkdrltiskdtsknqvvlkvtnmdpadtatyycardmifnfyfdvwgqgttvtvssastkqkslslspgk, qkslslspgkqvtlresgpalvkptqtltltctfsgfslstagmsvgwirqppgkalewladiwwddkkhyn, qvtlresgpalvkptqtltltctfsgfslstagmsvgwirqppgkalewladiwwddkkhyntlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqd, tlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcpapellggpsvflfppkpkd
Analysis of Glycopeptides Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer
LAAN-A-TM-E070 Application News No. B100 MALDI Mass Spectrometer Analysis of Glycopeptides Using MALDImini™-1 Compact MALDI Digital Ion Trap Mass Spectrometer Glycans, which are one post-translational modification of proteins, are molecules with high structural heterogeneity which are formed by complex bonding…
Key words
eeqynstyr, eeqynstyrglycopeptides, glycopeptidesglycan, glycanglycopeptide, glycopeptidemaldi, maldibinding, bindingspectrometer, spectrometersignals, signalsantibody, antibodycommercial, commercialglycoprotein, glycoproteinwave, wavebonding, bondingcompact, compactsites
Performance Evaluation of Microbial Identification Using a Benchtop MALDI-TOF MS
Matrix-Assisted Laser Desorption/Ionization Time-of-Flight Mass Spectrometer MALDI-TOF MS Microbial Identification Software Application News Performance Evaluation of Microbial Identification Using a Benchtop MALDI-TOF MS Yumi Unno, Tomonori Oshikawa, Kanae Teramoto User Benefits  Microbial species can be identified with high accuracy…
Key words
very, verybacillus, bacillushigh, highstaphylococcus, staphylococcusacinetobacter, acinetobactermicrococcus, micrococcuslactobacillus, lactobacillusmaldi, maldimicrobialtrack, microbialtrackmicrobial, microbiallactiplantibacillus, lactiplantibacilluslatilactobacillus, latilactobacilluslacticaseibacillus, lacticaseibacillusidentification, identificationlapidilactobacillus
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike