Comparison of Tandem and High Resolution Mass Spectrometry for the Quantification of the Monoclonal Antibody, Trastuzumab in Plasma
Technical notes | 2018 | WatersInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerWaters
Key wordsftisadtsk, dtyihwvr, trastuzumab, xevo, tandem, quadrupole, peptide, brief, mrm, bioanalytical, weighting, lod, performance, mass, accuracy, technology, plasma, precursor, curve, quantification, concentration, demand, spike, flight, spectrometer, fit, loq, proteinworks, using, summary, steadily, sensitivities, ion, µelution, achieved, linear, increased, prepared, attractive, express, rsd, acquisition, becoming, traditionally, achieves, tryptic, affinity, digested, surrogate, completed
Similar PDF
Optimizing Xevo G2-XS QTof Quadrupole Settings to Increase Sensitivity and Dynamic Range for the Analysis of Trastuzumab
2018|Waters|Technical notes
[ TECHNOLOGY BRIEF ] Optimizing Xevo G2-XS QTof Quadrupole Settings to Increase Sensitivity and Dynamic Range for the Analysis of Trastuzumab Marian Twohig, Yun Alelyunas, Caitlin Dunning, and Mark Wrona Waters Corporation, Milford, MA, USA The development of complex biotherapeutic…
Key words
trastuzumab, trastuzumabdtyihwvr, dtyihwvrftisadtsk, ftisadtskmass, masspeptide, peptidewindow, windowquadrupole, quadrupoleselection, selectioncharge, chargeconc, conchrms, hrmsinterference, interferenceisobaric, isobaricsensitivity, sensitivitymodalities
High Sensitivity LC-MS/MS Quantification of Monoclonal Antibody Drugs in Rat Plasma Using a Standardized Sample Preparation Workflow
2018|Waters|Applications
[ TECHNOLOGY BRIEF ] High Sensitivity LC-MS/MS Quantification of Monoclonal Antibody Drugs in Rat Plasma Using a Standardized Sample Preparation Workflow Mary Lame, Caitlin Dunning, Steven Calciano, and Kelly Doering Waters Corporation, Milford, MA, USA Protein therapeutics, specifically monoclonal antibodies…
Key words
adalimumab, adalimumabnylawyqqkpgk, nylawyqqkpgkinfliximab, infliximabquantification, quantificationsinsathyaesvk, sinsathyaesvktrastuzumab, trastuzumabiyptngytr, iyptngytrlloq, lloqinitial, initiallliyaastlqsgvpsr, lliyaastlqsgvpsrglewvsaitwnsghidyadsvegr, glewvsaitwnsghidyadsvegrasqfvgssihwyqqr, asqfvgssihwyqqrbrief, briefleesggglvqpggsmk, leesggglvqpggsmklliysasflysgvpsr
Accurate Bioanalytical Peptide Quantification of Salmon Calcitonin Using High Resolution Mass Spectrometry (HRMS)
2018|Waters|Applications
[ TECHNOLOGY BRIEF ] Accurate Bioanalytical Peptide Quantification of Salmon Calcitonin Using High Resolution Mass Spectrometry (HRMS) Mary Lame and Nikunj Tanna Waters Corporation, Milford, MA, USA The Xevo G2-XS QTof Mass Spectrometer used for quantification of salmon calcitonin (extracted…
Key words
calcitonin, calcitoninsalmon, salmonxevo, xevoquantification, quantificationprecursor, precursormrm, mrmbrief, briefserum, serumtof, tofhrms, hrmsmqc, mqclqc, lqchqc, hqccomparable, comparablesensitive
PEPTIDE AND PROTEIN BIOANALYSIS
2016|Waters|Guides
[ APPLICATION NOTEBOOK ] PEPTIDE AND PROTEIN BIOANALYSIS [ OUR SCIENTISTS ] Yun Alelyunas, PhD Before coming to Waters in 2012, Yun Alelyunas was a principal scientist and team leader at AstraZeneca for 20 years where she was involved in…
Key words
ionkey, ionkeypeptide, peptideplasma, plasmaquantification, quantificationhuman, humanxevo, xevoarea, areainsulin, insulinprotein, proteinuplc, uplcpeptides, peptidesmrm, mrmproteinworks, proteinworksantibody, antibodyusing