Comparison of Tandem and High Resolution Mass Spectrometry for the Quantification of the Monoclonal Antibody, Trastuzumab in Plasma
Technical notes | 2018 | WatersInstrumentation
Demand for precise bioanalytical quantification of therapeutic proteins continues to grow as monoclonal antibodies become more prevalent in drug development. High selectivity, sensitivity and broad dynamic range are critical for accurate pharmacokinetic and toxicokinetic studies.
This work compares the quantitative performance of a tandem quadrupole mass spectrometer (Xevo TQ-XS) and a high-resolution QTof instrument (Xevo G2-XS QTof) for measuring trastuzumab in plasma. Unique tryptic peptides (FTISADTSK and DTYIHWVR) serve as surrogates for antibody quantification.
Sample preparation involved immunoaffinity purification from plasma using a 96-well protein A plate, followed by enzymatic digestion and solid-phase extraction clean-up. Chromatographic separation used ACQUITY UPLC H-Class with a Peptide BEH C18 column and an eight-minute gradient. Quantitative analysis on the Xevo TQ-XS employed multiple reaction monitoring (MRM) for targeted peptide transitions. The Xevo G2-XS QTof was operated in three modes: Tof-MRM (product ion and precursor ion targeting) and full-scan MS.
• Xevo TQ-XS MRM achieved lower limits of quantification (LLOQs) of 10–25 ng/mL and a linear dynamic range spanning ≥4.3 orders of magnitude for both peptides.
• Xevo G2-XS QTof Tof-MRM delivered comparable performance with LLOQs of 25–50 ng/mL and linearity ≥4.0 orders, while alternative HRMS modes showed reduced sensitivity and narrower dynamic range.
• Quality-control samples on both platforms met accuracy (±15%) and precision criteria (%CV ≤15%).
• Chromatographic profiles demonstrated high specificity and signal-to-noise advantages for HRMS with narrow mass extraction windows.
The study confirms that high-resolution QTof instrumentation can match tandem quadrupole sensitivity for mAb quantification while offering added qualitative insights in a single run. This dual capability streamlines workflows in bioanalysis, supporting robust pharmacokinetic studies and QA/QC in pharmaceutical research.
• Broader adoption of HRMS-based MRM techniques in regulated bioanalysis.
• Integration of data-independent acquisition for simultaneous multi-attribute monitoring.
• Advanced software for enhanced mass accuracy and automated data processing.
• Expansion of high-throughput immunoaffinity-LC-MS workflows for complex biologics.
The Xevo G2-XS QTof system, operated in Tof-MRM mode, delivers sensitive, accurate and robust quantification of trastuzumab in plasma, with performance comparable to a state-of-the-art tandem quadrupole platform. This validates HRMS as a versatile tool for protein therapeutic analysis.
No external literature references were cited in the original text.
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerWaters
Summary
Significance of the topic
Demand for precise bioanalytical quantification of therapeutic proteins continues to grow as monoclonal antibodies become more prevalent in drug development. High selectivity, sensitivity and broad dynamic range are critical for accurate pharmacokinetic and toxicokinetic studies.
Objectives and study overview
This work compares the quantitative performance of a tandem quadrupole mass spectrometer (Xevo TQ-XS) and a high-resolution QTof instrument (Xevo G2-XS QTof) for measuring trastuzumab in plasma. Unique tryptic peptides (FTISADTSK and DTYIHWVR) serve as surrogates for antibody quantification.
Methodology and instrumentation
Sample preparation involved immunoaffinity purification from plasma using a 96-well protein A plate, followed by enzymatic digestion and solid-phase extraction clean-up. Chromatographic separation used ACQUITY UPLC H-Class with a Peptide BEH C18 column and an eight-minute gradient. Quantitative analysis on the Xevo TQ-XS employed multiple reaction monitoring (MRM) for targeted peptide transitions. The Xevo G2-XS QTof was operated in three modes: Tof-MRM (product ion and precursor ion targeting) and full-scan MS.
Main results and discussion
• Xevo TQ-XS MRM achieved lower limits of quantification (LLOQs) of 10–25 ng/mL and a linear dynamic range spanning ≥4.3 orders of magnitude for both peptides.
• Xevo G2-XS QTof Tof-MRM delivered comparable performance with LLOQs of 25–50 ng/mL and linearity ≥4.0 orders, while alternative HRMS modes showed reduced sensitivity and narrower dynamic range.
• Quality-control samples on both platforms met accuracy (±15%) and precision criteria (%CV ≤15%).
• Chromatographic profiles demonstrated high specificity and signal-to-noise advantages for HRMS with narrow mass extraction windows.
Benefits and practical applications
The study confirms that high-resolution QTof instrumentation can match tandem quadrupole sensitivity for mAb quantification while offering added qualitative insights in a single run. This dual capability streamlines workflows in bioanalysis, supporting robust pharmacokinetic studies and QA/QC in pharmaceutical research.
Future trends and applications
• Broader adoption of HRMS-based MRM techniques in regulated bioanalysis.
• Integration of data-independent acquisition for simultaneous multi-attribute monitoring.
• Advanced software for enhanced mass accuracy and automated data processing.
• Expansion of high-throughput immunoaffinity-LC-MS workflows for complex biologics.
Conclusion
The Xevo G2-XS QTof system, operated in Tof-MRM mode, delivers sensitive, accurate and robust quantification of trastuzumab in plasma, with performance comparable to a state-of-the-art tandem quadrupole platform. This validates HRMS as a versatile tool for protein therapeutic analysis.
References
No external literature references were cited in the original text.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Optimizing Xevo G2-XS QTof Quadrupole Settings to Increase Sensitivity and Dynamic Range for the Analysis of Trastuzumab
2018|Waters|Technical notes
[ TECHNOLOGY BRIEF ] Optimizing Xevo G2-XS QTof Quadrupole Settings to Increase Sensitivity and Dynamic Range for the Analysis of Trastuzumab Marian Twohig, Yun Alelyunas, Caitlin Dunning, and Mark Wrona Waters Corporation, Milford, MA, USA The development of complex biotherapeutic…
Key words
trastuzumab, trastuzumabdtyihwvr, dtyihwvrftisadtsk, ftisadtskmass, massquadrupole, quadrupolewindow, windowpeptide, peptideselection, selectionconc, conchrms, hrmscharge, chargeinterference, interferencesensitivity, sensitivityisobaric, isobaricbrief
High Sensitivity LC-MS/MS Quantification of Monoclonal Antibody Drugs in Rat Plasma Using a Standardized Sample Preparation Workflow
2018|Waters|Applications
[ TECHNOLOGY BRIEF ] High Sensitivity LC-MS/MS Quantification of Monoclonal Antibody Drugs in Rat Plasma Using a Standardized Sample Preparation Workflow Mary Lame, Caitlin Dunning, Steven Calciano, and Kelly Doering Waters Corporation, Milford, MA, USA Protein therapeutics, specifically monoclonal antibodies…
Key words
adalimumab, adalimumabnylawyqqkpgk, nylawyqqkpgksinsathyaesvk, sinsathyaesvkinfliximab, infliximabquantification, quantificationiyptngytr, iyptngytrtrastuzumab, trastuzumablloq, lloqinitial, initiallliyaastlqsgvpsr, lliyaastlqsgvpsrglewvsaitwnsghidyadsvegr, glewvsaitwnsghidyadsvegrasqfvgssihwyqqr, asqfvgssihwyqqrbrief, brieflliysasflysgvpsr, lliysasflysgvpsrleesggglvqpggsmk
Accurate Bioanalytical Peptide Quantification of Salmon Calcitonin Using High Resolution Mass Spectrometry (HRMS)
2018|Waters|Applications
[ TECHNOLOGY BRIEF ] Accurate Bioanalytical Peptide Quantification of Salmon Calcitonin Using High Resolution Mass Spectrometry (HRMS) Mary Lame and Nikunj Tanna Waters Corporation, Milford, MA, USA The Xevo G2-XS QTof Mass Spectrometer used for quantification of salmon calcitonin (extracted…
Key words
calcitonin, calcitoninsalmon, salmonxevo, xevoquantification, quantificationprecursor, precursormrm, mrmbrief, briefserum, serumtof, tofhrms, hrmsmqc, mqclqc, lqchqc, hqccomparable, comparablesensitive
PEPTIDE AND PROTEIN BIOANALYSIS
2016|Waters|Guides
[ APPLICATION NOTEBOOK ] PEPTIDE AND PROTEIN BIOANALYSIS [ OUR SCIENTISTS ] Yun Alelyunas, PhD Before coming to Waters in 2012, Yun Alelyunas was a principal scientist and team leader at AstraZeneca for 20 years where she was involved in…
Key words
ionkey, ionkeypeptide, peptideplasma, plasmaquantification, quantificationhuman, humanarea, areaxevo, xevoinsulin, insulinuplc, uplcprotein, proteinmrm, mrmproteinworks, proteinworkspeptides, peptidesantibody, antibodyusing