Accurate and Sensitive LC-MS/MS Quantification of Adalimumab in Serum/Plasma: Impact of Sample Preparation on Method Performance

Applications | 2018 | WatersInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
Industries
Clinical Research
Manufacturer
Waters

Summary

Importance of the topic


The accurate quantification of therapeutic monoclonal antibodies in biological matrices is critical for drug development, biosimilar research, and clinical dose optimization. Adalimumab (HUMIRA®), a leading anti–TNF-α antibody, presents analytical challenges due to its sequence homology with endogenous IgG and the broad concentration range encountered in pharmacokinetic and clinical studies.

Objectives and study overview


This application note evaluates a generic, kit-based LC-MS/MS workflow for adalimumab quantification in serum/plasma. Three sample preparation strategies of increasing complexity—direct digestion, generic protein-level immunoaffinity, and specific immunocapture—are compared to assess their impact on sensitivity, accuracy, and reproducibility.

Methodology and instrumentation


  • Sample preparation workflows:
    • Method 1: Direct digestion with ProteinWorks eXpress Direct Digest Kit followed by peptide-level clean-up using the µElution SPE Clean-Up Kit.
    • Method 2: Generic Protein A immunopurification, digestion with ProteinWorks eXpress Digest Kit, and SPE clean-up.
    • Method 3: Specific anti–human IgG Fc capture, digestion with ProteinWorks eXpress Digest Kit, without further SPE.
  • LC-MS/MS conditions:
    • UPLC: ACQUITY UPLC Peptide BEH C18, 300 Å, 1.7 µm, 2.1×150 mm column at 55 °C; gradient from 5% to 35% acetonitrile over 8 min at 0.3 mL/min.
    • MS: Xevo TQ-XS triple quadrupole, positive ESI, MRM detection of three signature tryptic peptides and a 15N13C-labeled SILuMAb internal standard, controlled by MassLynx 4.1 and TargetLynx software.

Main results and discussion


  • Peptide selection: Three unique adalimumab tryptic peptides (APYTFGQGTK, NYLAWYQQKPGK, GLEWVSAITWNSGHIDYADSVEGR) were identified via in silico digestion and confirmed for specificity and signal intensity.
  • Chromatography: The optimized gradient provided baseline separation of all peptides with peak widths under 5 s.
  • Sensitivity and dynamic range:
    • Method 1 LLOQ: 1,000–40,000 ng/mL
    • Method 2 LLOQ: 100–10,000 ng/mL
    • Method 3 LLOQ: 5–25 ng/mL
  • Linearity and precision: Calibration curves were linear (R²>0.99) across 1–5 orders of magnitude. QC precision (%RSD) was below 15% and accuracy ranged from 88% to 111% in all workflows.
  • Sample clean-up via SPE and immunoaffinity significantly improved signal-to-noise ratios and lowered quantification limits.

Benefits and practical applications


  • Modular, kit-based sample preparation simplifies method development for protein quantification, even for scientists accustomed to small-molecule workflows.
  • Flexible sensitivity tuning—from high-throughput, high-concentration assays to low-level clinical monitoring—by selecting the appropriate enrichment strategy.
  • Applicable platform for biosimilar development, PK/PD studies, and therapeutic drug monitoring in research and QC laboratories.

Future trends and applications


Emerging developments in high-throughput immunoenrichment, microflow LC, and advanced automation are expected to further boost sensitivity, throughput, and reproducibility. Integration with AI-driven peptide selection and real-time data analysis could accelerate method optimization for a broad range of biotherapeutics.

Conclusion


A standardized, kit-based LC-MS/MS approach, combined with tailored sample enrichment, achieves robust, accurate, and sensitive quantification of adalimumab in serum/plasma. Up-front immunoaffinity capture delivers the lowest detection limits, while simpler workflows remain suitable for higher concentration ranges, offering a versatile bioanalytical solution.

Reference


  1. DrugBank. Adalimumab protein sequence. 2017.
  2. Wikipedia. List of largest selling pharmaceutical products. 2017.
  3. GaBi Journal Editor. Patent expiry dates for biologicals. GABI J. 6(1):27–30, 2017.
  4. Colbert A, Umble-Romero A, Prokop S, et al. Bioanalytical strategy for biosimilar PK methods. MAbs. 6(5):1178–1189, 2014.
  5. Nowatzke WL, Rogers K, Wells E, et al. Challenges in bioanalytical support for biotherapeutics. Bioanalysis. 3(5):509–521, 2011.
  6. Islam R. Bioanalytical challenges of biosimilars. Bioanalysis. 6(3):349–356, 2014.
  7. Dreesen E, Bossuyt P, Mulleman D, et al. Therapeutic drug monitoring of biopharmaceuticals. Clin Pharmacology Adv Appl. 9:101–111, 2017.
  8. Ladwig PM, Barnidge DR, Willrich MAV. MS methods for therapeutic mAb quantitation. Clin Vaccine Immunol. 24(5):e00545–16, 2017.
  9. Abbott Laboratories. HUMIRA package insert. 2002.
  10. Pouw MF, Krieckaert CL, Nurmohamed MT, et al. Optimizing adalimumab treatment. Ann Rheum Dis. 74(3):513–518, 2015.
  11. Chen DY, Chen YM, Tsai WC, et al. Anti-drug antibodies and clinical response. Ann Rheum Dis. 74(3):e16, 2015.
  12. Skyline Targeted Mass Spec Environment. MacCoss Labs, UW. 2017.
  13. NCBI BLASTp. Basic Local Alignment Search Tool. 2017.
  14. FDA. Bioanalytical Method Validation Guidance for Industry. CDER.
  15. EMA. Guideline on Bioanalytical Method Validation. 2011.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Waters Application Notes - ProteinWorks
Waters Application Notes ProteinWorks OUR SCIENTISTS Erin E. Chambers As a principal scientist, Erin has been working almost exclusively on peptide and protein bioanalysis for the last seven years, while managing small and large molecule bioanalysis and clinical research applications…
Key words
proteinworks, proteinworksdigest, digestexpress, expressarea, areapeptide, peptidekit, kitgeneric, generictrastuzumab, trastuzumabplasma, plasmaftfsldtsk, ftfsldtskdigestion, digestionmurine, murineantibody, antibodyprotein, proteindstyslsstltlsk
Development of a Hybrid Immunoaffinity-LC-MS/MS Method for the Quantification of Active Biotherapeutics Targeting TNF-α in Serum
[ APPLICATION NOTE ] Development of a Hybrid Immunoaffinity-LC-MS/MS Method for the Quantification of Active Biotherapeutics Targeting TNF-α in Serum Caitlin Dunning and Mary Lame Waters Corporation, Milford, MA, USA APPLICATION BENEFITS ■■ ■■ High analytical sensitivity Tumor Necrosis Factor…
Key words
infliximab, infliximabimmunoaffinity, immunoaffinitynylawyqqkpgk, nylawyqqkpgkadalimumab, adalimumabsinsathyaesvk, sinsathyaesvkbiotherapeutics, biotherapeuticsetanercept, etanerceptictcrpgwycalsk, ictcrpgwycalsktnf, tnfquantification, quantificationserum, serumhybrid, hybridapytfgqgtk, apytfgqgtkactive, activedilltqspailsvspger
High Sensitivity LC-MS/MS Quantification of Monoclonal Antibody Drugs in Rat Plasma Using a Standardized Sample Preparation Workflow
[ TECHNOLOGY BRIEF ] High Sensitivity LC-MS/MS Quantification of Monoclonal Antibody Drugs in Rat Plasma Using a Standardized Sample Preparation Workflow Mary Lame, Caitlin Dunning, Steven Calciano, and Kelly Doering Waters Corporation, Milford, MA, USA Protein therapeutics, specifically monoclonal antibodies…
Key words
adalimumab, adalimumabnylawyqqkpgk, nylawyqqkpgksinsathyaesvk, sinsathyaesvkinfliximab, infliximabquantification, quantificationiyptngytr, iyptngytrtrastuzumab, trastuzumablloq, lloqinitial, initiallliyaastlqsgvpsr, lliyaastlqsgvpsrglewvsaitwnsghidyadsvegr, glewvsaitwnsghidyadsvegrasqfvgssihwyqqr, asqfvgssihwyqqrbrief, brieflliysasflysgvpsr, lliysasflysgvpsrleesggglvqpggsmk
A Universal, Optimized SPE Protocol for Clean-up of Tryptic Peptides in Protein Bioanalysis
A Universal, Optimized SPE Protocol for Clean-up of Tryptic Peptides in Protein Bioanalysis Mary Lame, Hua Yang, Sherri Naughton, and Erin Chambers G OA L As of 2013, there were 338 new monoclonal antibody To demonstrate the performance of an…
Key words
spe, speproteinworks, proteinworksdigest, digestµelution, µelutionmurine, murineigg, iggprotein, proteinaffinity, affinityhumira, humirageneric, genericpeptides, peptidesclean, cleankit, kitplasma, plasmatryptic
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike