Accurate and Sensitive LC-MS/MS Quantification of Adalimumab in Serum/Plasma: Impact of Sample Preparation on Method Performance
Applications | 2018 | WatersInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerWaters
Key wordsadalimumab, serum, glewvsaitwnsghidyadsvegr, quantification, nylawyqqkpgk, apytfgqgtk, proteinworks, plasma, protein, spe, peptide, accurate, digestion, digest, sensitive, generic, therapeutic, xevo, express, clean, kit, tryptic, affinity, lmiydatk, application, note, µelution, human, level, peptides, sensitivity, dtlmisr, gpsvfplapssk, preparation, mab, blank, drug, support, direct, sample, molecule, immunoaffinity, biological, signature, development, rat, uplc, targetlynx, bioanalytical, acquity
Similar PDF
Waters Application Notes - ProteinWorks
2016|Waters|Guides
Waters Application Notes ProteinWorks OUR SCIENTISTS Erin E. Chambers As a principal scientist, Erin has been working almost exclusively on peptide and protein bioanalysis for the last seven years, while managing small and large molecule bioanalysis and clinical research applications…
Key words
proteinworks, proteinworksdigest, digestexpress, expressarea, areapeptide, peptidekit, kittrastuzumab, trastuzumabgeneric, genericplasma, plasmadigestion, digestionftfsldtsk, ftfsldtskmurine, murineantibody, antibodyprotein, proteinsignature
High Sensitivity LC-MS/MS Quantification of Monoclonal Antibody Drugs in Rat Plasma Using a Standardized Sample Preparation Workflow
2018|Waters|Applications
[ TECHNOLOGY BRIEF ] High Sensitivity LC-MS/MS Quantification of Monoclonal Antibody Drugs in Rat Plasma Using a Standardized Sample Preparation Workflow Mary Lame, Caitlin Dunning, Steven Calciano, and Kelly Doering Waters Corporation, Milford, MA, USA Protein therapeutics, specifically monoclonal antibodies…
Key words
adalimumab, adalimumabnylawyqqkpgk, nylawyqqkpgkinfliximab, infliximabsinsathyaesvk, sinsathyaesvkquantification, quantificationtrastuzumab, trastuzumabiyptngytr, iyptngytrlloq, lloqinitial, initiallliyaastlqsgvpsr, lliyaastlqsgvpsrasqfvgssihwyqqr, asqfvgssihwyqqrglewvsaitwnsghidyadsvegr, glewvsaitwnsghidyadsvegrbrief, briefleesggglvqpggsmk, leesggglvqpggsmklliysasflysgvpsr
Development of a Hybrid Immunoaffinity-LC-MS/MS Method for the Quantification of Active Biotherapeutics Targeting TNF-α in Serum
2018|Waters|Applications
[ APPLICATION NOTE ] Development of a Hybrid Immunoaffinity-LC-MS/MS Method for the Quantification of Active Biotherapeutics Targeting TNF-α in Serum Caitlin Dunning and Mary Lame Waters Corporation, Milford, MA, USA APPLICATION BENEFITS ■■ ■■ High analytical sensitivity Tumor Necrosis Factor…
Key words
infliximab, infliximabimmunoaffinity, immunoaffinitynylawyqqkpgk, nylawyqqkpgkadalimumab, adalimumabbiotherapeutics, biotherapeuticssinsathyaesvk, sinsathyaesvketanercept, etanercepttnf, tnfictcrpgwycalsk, ictcrpgwycalskquantification, quantificationserum, serumhybrid, hybridapytfgqgtk, apytfgqgtkactive, activedilltqspailsvspger
A Generic Kit-Based Approach for Quantifying Monoclonal Antibody Drugs Through Direct Digestion of Discovery Study Samples
2015|Waters|Applications
A Generic Kit-Based Approach for Quantifying Monoclonal Antibody Drugs Through Direct Digestion of Discovery Study Samples Mary Lame, Hua Yang, Sherri Naughton, and Erin Chambers Waters Corporation, Milford, MA, USA A P P L I C AT I O N…
Key words
generic, genericsignature, signaturehrough, hroughkit, kitapytfgqgtk, apytfgqgtkbevacizumab, bevacizumabsinsathyaesvk, sinsathyaesvkftfsldtsk, ftfsldtskmonoclonal, monoclonalantibody, antibodyftisadtsk, ftisadtskquantifying, quantifyingproteinworks, proteinworksdirect, directdigestion