LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Development of a Hybrid Immunoaffinity-LC-MS/MS Method for the Quantification of Active Biotherapeutics Targeting TNF-α in Serum

 

Similar PDF

Toggle
[ APPLICATION NOTE ] Accurate and Sensitive LC-MS/MS Quantification of Adalimumab in Serum/Plasma: Impact of Sample Preparation on Method Performance Caitlin Dunning, Mary Lame, Steven Calciano, and Kelly Doering Waters Corporation, Milford, MA, USA APPLICATION BENEFITS ■■ ■■ Speed and…
Key words
adalimumab, adalimumabserum, serumglewvsaitwnsghidyadsvegr, glewvsaitwnsghidyadsvegrquantification, quantificationnylawyqqkpgk, nylawyqqkpgkapytfgqgtk, apytfgqgtkproteinworks, proteinworksplasma, plasmaprotein, proteinspe, spepeptide, peptideaccurate, accuratedigestion, digestiondigest, digestsensitive
[ TECHNOLOGY BRIEF ] High Sensitivity LC-MS/MS Quantification of Monoclonal Antibody Drugs in Rat Plasma Using a Standardized Sample Preparation Workflow Mary Lame, Caitlin Dunning, Steven Calciano, and Kelly Doering Waters Corporation, Milford, MA, USA Protein therapeutics, specifically monoclonal antibodies…
Key words
adalimumab, adalimumabnylawyqqkpgk, nylawyqqkpgkinfliximab, infliximabquantification, quantificationsinsathyaesvk, sinsathyaesvktrastuzumab, trastuzumabiyptngytr, iyptngytrlloq, lloqinitial, initiallliyaastlqsgvpsr, lliyaastlqsgvpsrglewvsaitwnsghidyadsvegr, glewvsaitwnsghidyadsvegrasqfvgssihwyqqr, asqfvgssihwyqqrbrief, briefleesggglvqpggsmk, leesggglvqpggsmklliysasflysgvpsr
HYBRID LC-MS/MS FOR QUANTIFICATION OF INFLIXIMAB IN CROHN’S DISEASE PATIENT SAMPLES: DOES IT ADD VALUE? Caitlin M. Dunning1, Mary Lame1, Paula Orens1, Dominic Foley2, Ian Edwards1, Kelly Doering1, Jenny Leung3, Mark Ward4, Peter Irving5, and Zehra Arkir3 1 Waters Corporation,…
Key words
ifx, ifxtracker, trackerlisa, lisatnf, tnfhybrid, hybriddigestion, digestioninfliximab, infliximabdirect, directsinsathyaesvk, sinsathyaesvkpatient, patientbablok, bablokdrug, drugelisa, elisaassay, assayquantification
Waters Application Notes ProteinWorks OUR SCIENTISTS Erin E. Chambers As a principal scientist, Erin has been working almost exclusively on peptide and protein bioanalysis for the last seven years, while managing small and large molecule bioanalysis and clinical research applications…
Key words
proteinworks, proteinworksdigest, digestexpress, expressarea, areapeptide, peptidekit, kittrastuzumab, trastuzumabgeneric, genericplasma, plasmadigestion, digestionftfsldtsk, ftfsldtskmurine, murineantibody, antibodyprotein, proteinsignature
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike