Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis
Posters | 2013 | ShimadzuInstrumentation
LC/TOF, LC/MS, LC/MS/MS, LC/IT
IndustriesFood & Agriculture
ManufacturerShimadzu
Key wordsumtic, allergen, imer, overcoming, protein, trypsin, food, min, digestion, challenges, sample, extract, sfnldeghalr, desalting, perfinity, preparation, idp, incubations, alkylation, chromatograms, immobilized, beef, automates, tof, ion, tryptic, consecutive, plexed, spetrum, column, nora, analysis, matricies, lcms, foods, inten, nnpfyfpsr, total, peptides, reduction, iodoacetamide, peptide, platform, proteins, reversed, rpc, using, banana, severity, incubate
Similar PDF
Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis
2013|Shimadzu|Posters
PO-CON1362E Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis ASMS 2013 TP-756 Rachel Lieberman1, Brian Feild1, Kevin Meyer2, Nick Herold2, Scott Kuzdzal1, Kevin Meyer2, Nick Herold2 1 Shimadzu Scientific Instruments, Columbia, MD 2 Perfinity Biosciences, Inc., West Lafeyette,…
Key words
umtic, umticallergen, allergenovercoming, overcomingimer, imerprotein, proteinfood, foodtrypsin, trypsinmin, mindigestion, digestionchallenges, challengessample, sampleextract, extractsfnldeghalr, sfnldeghalrperfinity, perfinitydesalting
A Rapid and Reproducible Immuno-MS Platform from Sample Collection to Quantitation of IgG
2014|Shimadzu|Posters
PO-CON1457E A Rapid and Reproducible Immuno-MS Platform from Sample Collection to Quantitation of IgG ASMS 2014 ThP766 Rachel Lieberman1, David Colquhoun1, Jeremy Post1, Brian Feild1, Scott Kuzdzal1, Fred Regnier2, 1 Shimadzu Scientific Instruments, Columbia, MD, USA 2 Novilytic L.L.C, North…
Key words
immuno, immunoigg, iggttppvldsdgsfflysk, ttppvldsdgsfflyskvvsvltvlhqdwlngk, vvsvltvlhqdwlngkcollection, collectionplatform, platformrapid, rapidreproducible, reproduciblecards, cardsplamsa, plamsanoviplex, noviplexquantitation, quantitationsample, sampleplasma, plasmablood
Analysis of Hemoglobin Variants using an Automated Sample Preparation Workstation Coupled to LC-MS
|Shimadzu|Posters
Analysis of Hemoglobin Variants using an Automated Sample Preparation Workstation Coupled to LC-MS Rachel Lieberman , Brian Feild , Kevin Meyer , Nick Herold , Scott Kuzdzal 1 1 2 2 Shimadzu Scientific Instruments, Columbia, MD Perfinity Biosciences, Inc., West…
Key words
sickle, sickleidentification, identificationwaste, wastehemoglobin, hemoglobinaffinity, affinitydigestion, digestionpurified, purifiedflight, flightvariants, variantstargets, targetsfive, fivelcms, lcmsquantification, quantificationimmunoassay, immunoassaycell
High Sensitivity Analysis of Peanut Allergen in Cumin and Spice Mix [LCMS-8060]
2016|Shimadzu|Applications
LAAN-A-LM-E112 Application News Liquid Chromatography Mass Spectrometry High Sensitivity Analysis of Peanut Allergen in Cumin and Spice Mix [LCMS-8060] C141 No. Food allergens are a major public health concern. Among them, peanut allergy is one of the common food allergies.…
Key words
peanut, peanutsurfactant, surfactanttransitions, transitionsfile, fileallergen, allergenmrm, mrmthyme, thymenews, newspeanuts, peanutsmin, minchili, chiliblank, blankdigestion, digestionspiked, spikedsensitivity