Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis

Posters | 2013 | ShimadzuInstrumentation
LC/TOF, LC/MS, LC/MS/MS, LC/IT
Industries
Food & Agriculture
Manufacturer
Shimadzu

Summary

Importance of the Topic


Food allergies affect millions worldwide, with peanut allergen Ara h1 one of the most clinically relevant triggers. Trace levels of allergenic proteins can contaminate unexpected products, leading to severe reactions. Rapid, reproducible, and sensitive analytical workflows are therefore essential for regulatory compliance, consumer safety, and quality control in the food industry.

Goals and Overview of the Study


This work demonstrates an automated on-line sample preparation platform (Perfinity iDP) coupled to LC-MS for high-throughput proteolysis, desalting, separation, and detection of food allergens. Key objectives included:
  • Reducing digestion time from hours to minutes.
  • Evaluating reproducibility and multiplexing capacity for 200 samples per day.
  • Identifying and quantifying tryptic peptides of Ara h1 in complex food matrices.

Methodology and Instrumentation


The automated Perfinity Integrated Digestion Platform (iDP) incorporates:
  • Immobilized trypsin reactor (IMER) for rapid on-line digestion (2–8 min) at controlled temperatures (40–70 °C), including a NoRA high-temperature protocol eliminating reduction/alkylation steps.
  • Online desalting via peptide C18 trap.
  • Reversed-phase HPLC (Phenomenex Aeris PEPTIDE 2.1×100 mm) with a 15 min gradient (5–50% acetonitrile, 0.1% formic acid).
  • Direct coupling to Shimadzu IT-TOF and triple quadrupole mass spectrometers for peptide identification and quantitation.

Main Results and Discussion


Optimization experiments established that an 8 min digest at 70 °C provided complete and reproducible cleavage of Ara h1. Process coefficient of variation (CV) was under 10% across multiple injections for hemoglobin and Ara h1 standards. MS/MS confirmed identification of the signature peptide SFNLDEGHALR (m/z 629.8) with abundant b/y ion series. Matrix spiking into baby food extracts (beef, juice, banana, sweet potato) showed distinct peptide profiles in total ion chromatograms. Calibration curves generated from selected ion chromatograms exhibited linear responses (R2 ≥0.98) down to 1 µg/mL Ara h1.

Benefits and Practical Applications


The fully automated workflow delivers:
  • High throughput processing (up to 200 samples/day) via multiplexed desalting columns.
  • Less than one-hour sample turnaround, enhancing laboratory efficiency.
  • Robust quantitation suitable for regulatory labs, QA/QC environments, and research on allergen contamination.

Future Trends and Opportunities


Emerging directions include:
  • Integration of nanoflow LC and high-resolution mass analyzers for enhanced sensitivity.
  • Expansion to multi-allergen panels using MS-based multiple reaction monitoring (MRM) assays.
  • Deployment of AI-driven data analysis for rapid peptide identification and quantitation in complex matrices.
  • Miniaturized, field-deployable platforms for on-site allergen testing.

Conclusion


The Perfinity iDP system streamlines protein digestion, desalting, and LC separation, significantly accelerating food allergen analysis with high reproducibility. Coupling to MS platforms provides reliable identification and quantitation of Ara h1 peptides in diverse food matrices, supporting food safety initiatives and regulatory compliance.

Reference


Lieberman R., Feild B., Meyer K., Herold N., Kuzdzal S. Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis. ASMS 2013, TP-756.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis
PO-CON1362E Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis ASMS 2013 TP-756 Rachel Lieberman1, Brian Feild1, Kevin Meyer2, Nick Herold2, Scott Kuzdzal1, Kevin Meyer2, Nick Herold2 1 Shimadzu Scientific Instruments, Columbia, MD 2 Perfinity Biosciences, Inc., West Lafeyette,…
Key words
umtic, umticallergen, allergenimer, imerovercoming, overcomingprotein, proteinfood, foodmin, mintrypsin, trypsindigestion, digestionchallenges, challengessample, sampleextract, extractsfnldeghalr, sfnldeghalrperfinity, perfinitydesalting
A Rapid and Reproducible Immuno-MS Platform from Sample Collection to Quantitation of IgG
PO-CON1457E A Rapid and Reproducible Immuno-MS Platform from Sample Collection to Quantitation of IgG ASMS 2014 ThP766 Rachel Lieberman1, David Colquhoun1, Jeremy Post1, Brian Feild1, Scott Kuzdzal1, Fred Regnier2, 1 Shimadzu Scientific Instruments, Columbia, MD, USA 2 Novilytic L.L.C, North…
Key words
immuno, immunoigg, iggttppvldsdgsfflysk, ttppvldsdgsfflyskvvsvltvlhqdwlngk, vvsvltvlhqdwlngkcollection, collectionplatform, platformrapid, rapidreproducible, reproducibleplamsa, plamsacards, cardsnoviplex, noviplexquantitation, quantitationsample, sampleplasma, plasmablood
Analysis of Hemoglobin Variants using an Automated Sample Preparation Workstation Coupled to LC-MS
Analysis of Hemoglobin Variants using an Automated Sample Preparation Workstation Coupled to LC-MS Rachel Lieberman , Brian Feild , Kevin Meyer , Nick Herold , Scott Kuzdzal 1 1 2 2 Shimadzu Scientific Instruments, Columbia, MD Perfinity Biosciences, Inc., West…
Key words
sickle, sickleidentification, identificationwaste, wastehemoglobin, hemoglobinaffinity, affinitydigestion, digestionpurified, purifiedflight, flightvariants, variantstargets, targetsfive, fivelcms, lcmsquantification, quantificationimmunoassay, immunoassaycell
High Sensitivity Analysis of Peanut Allergen in Cumin and Spice Mix [LCMS-8060]
LAAN-A-LM-E112 Application News Liquid Chromatography Mass Spectrometry High Sensitivity Analysis of Peanut Allergen in Cumin and Spice Mix [LCMS-8060] C141 No. Food allergens are a major public health concern. Among them, peanut allergy is one of the common food allergies.…
Key words
peanut, peanuttransitions, transitionssurfactant, surfactantallergen, allergenfile, filemrm, mrmthyme, thymenews, newspeanuts, peanutsmin, minchili, chilispiked, spikedblank, blankdigestion, digestionsensitivity
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike