LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis

 

Similar PDF

Toggle
PO-CON1362E Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis ASMS 2013 TP-756 Rachel Lieberman1, Brian Feild1, Kevin Meyer2, Nick Herold2, Scott Kuzdzal1, Kevin Meyer2, Nick Herold2 1 Shimadzu Scientific Instruments, Columbia, MD 2 Perfinity Biosciences, Inc., West Lafeyette,…
Key words
umtic, umticallergen, allergenimer, imerovercoming, overcomingprotein, proteinfood, foodtrypsin, trypsinmin, mindigestion, digestionchallenges, challengessample, sampleextract, extractsfnldeghalr, sfnldeghalrperfinity, perfinitydesalting
PO-CON1457E A Rapid and Reproducible Immuno-MS Platform from Sample Collection to Quantitation of IgG ASMS 2014 ThP766 Rachel Lieberman1, David Colquhoun1, Jeremy Post1, Brian Feild1, Scott Kuzdzal1, Fred Regnier2, 1 Shimadzu Scientific Instruments, Columbia, MD, USA 2 Novilytic L.L.C, North…
Key words
immuno, immunoigg, iggttppvldsdgsfflysk, ttppvldsdgsfflyskvvsvltvlhqdwlngk, vvsvltvlhqdwlngkcollection, collectionplatform, platformrapid, rapidreproducible, reproduciblecards, cardsplamsa, plamsanoviplex, noviplexquantitation, quantitationsample, sampleplasma, plasmablood
LAAN-A-LM-E112 Application News Liquid Chromatography Mass Spectrometry High Sensitivity Analysis of Peanut Allergen in Cumin and Spice Mix [LCMS-8060] C141 No. Food allergens are a major public health concern. Among them, peanut allergy is one of the common food allergies.…
Key words
peanut, peanutsurfactant, surfactanttransitions, transitionsallergen, allergenfile, filemrm, mrmthyme, thymenews, newspeanuts, peanutsmin, minchili, chiliblank, blankspiked, spikeddigestion, digestionsensitivity
LAAN-A-LM-E112 Application News Liquid Chromatography Mass Spectrometry High Sensitivity Analysis of Peanut Allergen in Cumin and Spice Mix [LCMS-8060] C141 No. Food allergens are a major public health concern. Among them, peanut allergy is one of the common food allergies.…
Key words
peanut, peanutsurfactant, surfactanttransitions, transitionsallergen, allergenfile, filemrm, mrmthyme, thymenews, newspeanuts, peanutsmin, minchili, chiliblank, blankspiked, spikeddigestion, digestionsensitivity
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike