Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis
Posters | 2013 | ShimadzuInstrumentation
Food allergens pose serious health risks, from skin irritation to anaphylaxis. Sensitive and reproducible detection of trace proteins such as Ara h 1 is essential for food safety. Automating sample preparation enhances throughput and consistency for regulatory compliance.
This work evaluates an online integrated digestion platform to streamline proteolysis, desalting, and LC MS analysis of the peanut allergen Ara h 1 in complex food matrices. Goals include method automation, rapid turnaround, high reproducibility, and quantitative performance in baby food extracts.
Efficient digestion of Ara h 1 was achieved in 2 to 8 minutes with coefficients of variation under ten percent. Multiplexed workflows enabled analysis of up to 200 samples per day. Key tryptic peptides, including SFNLDEGHALR (m/z 629.8), were identified with abundant fragment ions. Quantitation in spiked baby food matrices (beef, juice, sweet potato, banana) yielded linear calibration curves with r2 values above 0.97 across 1 to 10 micrograms per milliliter.
Integrating reduction and alkylation steps directly into the online platform could further simplify workflows. Extending automated digestion to other allergenic proteins and clinical samples may broaden application. Advances in reactor miniaturization and coupling with high resolution mass spectrometers promise even faster and more sensitive analyses.
The Perfinity iDP coupled with LCMS IT TOF effectively automates and accelerates protein digestion and analysis, delivering rapid, reproducible, and quantitative results for food allergen detection. This platform represents a powerful solution for high throughput proteomic workflows in food safety laboratories.
No explicit literature references were provided in the original document.
Sample Preparation, LC/TOF, LC/MS, LC/MS/MS, LC/IT
IndustriesFood & Agriculture, Proteomics
ManufacturerShimadzu
Summary
Significance of the topic
Food allergens pose serious health risks, from skin irritation to anaphylaxis. Sensitive and reproducible detection of trace proteins such as Ara h 1 is essential for food safety. Automating sample preparation enhances throughput and consistency for regulatory compliance.
Study objectives and overview
This work evaluates an online integrated digestion platform to streamline proteolysis, desalting, and LC MS analysis of the peanut allergen Ara h 1 in complex food matrices. Goals include method automation, rapid turnaround, high reproducibility, and quantitative performance in baby food extracts.
Methodology and instrumentation
- Sample pretreatment involved reduction with dithiothreitol and alkylation with iodoacetamide, yielding 220 ppm Ara h 1.
- Automated digestion used the Perfinity Integrated Digestion Platform (iDP) with immobilized trypsin reactor (IMER), online C18 desalting, and reversed phase LC.
- Chromatography employed a Phenomenex Aeris PEPTIDE column (2.1×100 mm, 3.6 μm) with a 15 minute gradient from 5 to 50 percent acetonitrile containing 0.1 percent formic acid at 500 μL per minute.
- Detection was performed on a Shimadzu ion trap time of flight instrument for peptide identification and on an LCMS 8030 triple quadrupole for reproducibility studies.
Main results and discussion
Efficient digestion of Ara h 1 was achieved in 2 to 8 minutes with coefficients of variation under ten percent. Multiplexed workflows enabled analysis of up to 200 samples per day. Key tryptic peptides, including SFNLDEGHALR (m/z 629.8), were identified with abundant fragment ions. Quantitation in spiked baby food matrices (beef, juice, sweet potato, banana) yielded linear calibration curves with r2 values above 0.97 across 1 to 10 micrograms per milliliter.
Benefits and practical applications
- Reduces sample preparation time from 24 hours to under one hour.
- Delivers high reproducibility (CV below 10 percent) for QA QC workflows.
- Enables multiplexing to achieve high throughput required for routine food safety testing.
- Provides quantitative recovery of allergenic peptides in diverse food matrices.
Future trends and opportunities
Integrating reduction and alkylation steps directly into the online platform could further simplify workflows. Extending automated digestion to other allergenic proteins and clinical samples may broaden application. Advances in reactor miniaturization and coupling with high resolution mass spectrometers promise even faster and more sensitive analyses.
Conclusion
The Perfinity iDP coupled with LCMS IT TOF effectively automates and accelerates protein digestion and analysis, delivering rapid, reproducible, and quantitative results for food allergen detection. This platform represents a powerful solution for high throughput proteomic workflows in food safety laboratories.
References
No explicit literature references were provided in the original document.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis
2013|Shimadzu|Posters
PO-CON1362E Overcoming Challenges of Protein Sample Preparation for Food Allergen Analysis ASMS 2013 TP-756 Rachel Lieberman1, Brian Feild1, Kevin Meyer2, Nick Herold2, Scott Kuzdzal1, Kevin Meyer2, Nick Herold2 1 Shimadzu Scientific Instruments, Columbia, MD 2 Perfinity Biosciences, Inc., West Lafeyette,…
Key words
umtic, umticallergen, allergenovercoming, overcomingimer, imerprotein, proteinfood, foodtrypsin, trypsinmin, mindigestion, digestionchallenges, challengessample, sampleextract, extractsfnldeghalr, sfnldeghalrperfinity, perfinitydesalting
A Rapid and Reproducible Immuno-MS Platform from Sample Collection to Quantitation of IgG
2014|Shimadzu|Posters
PO-CON1457E A Rapid and Reproducible Immuno-MS Platform from Sample Collection to Quantitation of IgG ASMS 2014 ThP766 Rachel Lieberman1, David Colquhoun1, Jeremy Post1, Brian Feild1, Scott Kuzdzal1, Fred Regnier2, 1 Shimadzu Scientific Instruments, Columbia, MD, USA 2 Novilytic L.L.C, North…
Key words
immuno, immunoigg, iggttppvldsdgsfflysk, ttppvldsdgsfflyskvvsvltvlhqdwlngk, vvsvltvlhqdwlngkcollection, collectionplatform, platformrapid, rapidreproducible, reproducibleplamsa, plamsacards, cardsnoviplex, noviplexquantitation, quantitationsample, sampleplasma, plasmablood
Analysis of Hemoglobin Variants using an Automated Sample Preparation Workstation Coupled to LC-MS
|Shimadzu|Posters
Analysis of Hemoglobin Variants using an Automated Sample Preparation Workstation Coupled to LC-MS Rachel Lieberman , Brian Feild , Kevin Meyer , Nick Herold , Scott Kuzdzal 1 1 2 2 Shimadzu Scientific Instruments, Columbia, MD Perfinity Biosciences, Inc., West…
Key words
sickle, sickleidentification, identificationwaste, wastehemoglobin, hemoglobinaffinity, affinitydigestion, digestionpurified, purifiedflight, flightvariants, variantstargets, targetsfive, fivelcms, lcmsquantification, quantificationimmunoassay, immunoassaycell
High Sensitivity Analysis of Peanut Allergen in Cumin and Spice Mix [LCMS-8060]
2016|Shimadzu|Applications
LAAN-A-LM-E112 Application News Liquid Chromatography Mass Spectrometry High Sensitivity Analysis of Peanut Allergen in Cumin and Spice Mix [LCMS-8060] C141 No. Food allergens are a major public health concern. Among them, peanut allergy is one of the common food allergies.…
Key words
peanut, peanuttransitions, transitionssurfactant, surfactantallergen, allergenfile, filemrm, mrmthyme, thymenews, newspeanuts, peanutsmin, minchili, chilispiked, spikedblank, blankdigestion, digestionsensitivity