Login
LabRulez
Registration
Settings
Filter
Filter
Password reset
Password reset
 

Similar PDF

LAAN-A-LM-E112ApplicationNewsLiquid Chromatography Mass SpectrometryHigh Sensitivity Analysis of Peanut Allergen inCumin and Spice Mix [LCMS-8060]C141No.Food allergens are a major public health concern.Among them, peanut allergy is one of the commonfood allergies. To avoid unexpected contact with foodallergens, food labels are strictly...
Key words
peanut, peanutsurfactant, surfactanttransitions, transitionsfile, fileallergen, allergenmrm, mrmthyme, thymenews, newsdigestion, digestionpeanuts, peanutschili, chiliblank, blankspiked, spikedmin, minsensitivity
PO-CON1457EA Rapid and Reproducible Immuno-MSPlatform from Sample Collection toQuantitation of IgGASMS 2014ThP766Rachel Lieberman1, David Colquhoun1, Jeremy Post1,Brian Feild1, Scott Kuzdzal1, Fred Regnier2,1Shimadzu Scientific Instruments, Columbia, MD, USA2Novilytic L.L.C, North Webster, IN, USA A Rapid and Reproducible Immuno-MS Platform from SampleCollection to...
Key words
immuno, immunoigg, iggttppvldsdgsfflysk, ttppvldsdgsfflyskvvsvltvlhqdwlngk, vvsvltvlhqdwlngkcollection, collectionplatform, platformrapid, rapidreproducible, reproduciblecards, cardsplamsa, plamsanoviplex, noviplexquantitation, quantitationsample, sampleplasma, plasmaseparator
PO-CON1362EOvercoming Challenges ofProtein Sample Preparation forFood Allergen AnalysisASMS 2013TP-756Rachel Lieberman1, Brian Feild1, Kevin Meyer2,Nick Herold2, Scott Kuzdzal1, Kevin Meyer2, NickHerold21Shimadzu Scientific Instruments, Columbia, MD2Perfinity Biosciences, Inc., West Lafeyette, IN Overcoming Challenges of Protein Sample Preparation forFood Allergen Analysis1.OverviewAn on-line sample preparation...
Key words
umtic, umticallergen, allergenovercoming, overcomingprotein, proteinimer, imertrypsin, trypsinfood, foodmin, mindigestion, digestionchallenges, challengessample, sampleextract, extractsfnldeghalr, sfnldeghalrdesalting, desaltingpreparation
Analysis of Hemoglobin Variants using an Automated Sample Preparation Workstation Coupled to LC-MSRachel Lieberman , Brian Feild , Kevin Meyer , Nick Herold , Scott Kuzdzal1122Shimadzu Scientific Instruments, Columbia, MD Perfinity Biosciences, Inc., West Lafeyette, IN1 12Immunoassay vs. ChromatographyIntroductionSickle Cell...
Key words
sickle, sickleidentification, identificationwaste, wastehemoglobin, hemoglobindigestion, digestionaffinity, affinitypurified, purifiedvariants, variantsflight, flightfive, fivetargets, targetscell, cellquantification, quantificationimmunoassay, immunoassaylcms
 

Similar PDF

LAAN-A-LM-E112ApplicationNewsLiquid Chromatography Mass SpectrometryHigh Sensitivity Analysis of Peanut Allergen inCumin and Spice Mix [LCMS-8060]C141No.Food allergens are a major public health concern.Among them, peanut allergy is one of the commonfood allergies. To avoid unexpected contact with foodallergens, food labels are strictly...
Key words
peanut, peanutsurfactant, surfactanttransitions, transitionsfile, fileallergen, allergenmrm, mrmthyme, thymenews, newsdigestion, digestionpeanuts, peanutschili, chiliblank, blankspiked, spikedmin, minsensitivity
PO-CON1457EA Rapid and Reproducible Immuno-MSPlatform from Sample Collection toQuantitation of IgGASMS 2014ThP766Rachel Lieberman1, David Colquhoun1, Jeremy Post1,Brian Feild1, Scott Kuzdzal1, Fred Regnier2,1Shimadzu Scientific Instruments, Columbia, MD, USA2Novilytic L.L.C, North Webster, IN, USA A Rapid and Reproducible Immuno-MS Platform from SampleCollection to...
Key words
immuno, immunoigg, iggttppvldsdgsfflysk, ttppvldsdgsfflyskvvsvltvlhqdwlngk, vvsvltvlhqdwlngkcollection, collectionplatform, platformrapid, rapidreproducible, reproduciblecards, cardsplamsa, plamsanoviplex, noviplexquantitation, quantitationsample, sampleplasma, plasmaseparator
PO-CON1362EOvercoming Challenges ofProtein Sample Preparation forFood Allergen AnalysisASMS 2013TP-756Rachel Lieberman1, Brian Feild1, Kevin Meyer2,Nick Herold2, Scott Kuzdzal1, Kevin Meyer2, NickHerold21Shimadzu Scientific Instruments, Columbia, MD2Perfinity Biosciences, Inc., West Lafeyette, IN Overcoming Challenges of Protein Sample Preparation forFood Allergen Analysis1.OverviewAn on-line sample preparation...
Key words
umtic, umticallergen, allergenovercoming, overcomingprotein, proteinimer, imertrypsin, trypsinfood, foodmin, mindigestion, digestionchallenges, challengessample, sampleextract, extractsfnldeghalr, sfnldeghalrdesalting, desaltingpreparation
Analysis of Hemoglobin Variants using an Automated Sample Preparation Workstation Coupled to LC-MSRachel Lieberman , Brian Feild , Kevin Meyer , Nick Herold , Scott Kuzdzal1122Shimadzu Scientific Instruments, Columbia, MD Perfinity Biosciences, Inc., West Lafeyette, IN1 12Immunoassay vs. ChromatographyIntroductionSickle Cell...
Key words
sickle, sickleidentification, identificationwaste, wastehemoglobin, hemoglobindigestion, digestionaffinity, affinitypurified, purifiedvariants, variantsflight, flightfive, fivetargets, targetscell, cellquantification, quantificationimmunoassay, immunoassaylcms
 

Related content

Quantitation of Pesticide Residues in Milk Using the Agilent 6470 Triple Quadrupole LC/MS

Aplikace
| 2021 | Agilent Technologies
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Potraviny a zemědělství

Utilization of the ACQUITY PREMIER System and Column for Improved Oligonucleotide Bioanalytical Chromatographic Performance

Aplikace
| 2021 | Waters
Instrumentation
Consumables, LC/MS, LC/MS/MS, LC columns, LC/QQQ
Manufacturer
Waters
Industries
Klinická analýza

Development of Profiling Method for Major Lipids in Blood by Triple Quadrupole LC/MS/MS

Aplikace
| 2021 | Shimadzu
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Shimadzu
Industries
Klinická analýza
 

Related content

Quantitation of Pesticide Residues in Milk Using the Agilent 6470 Triple Quadrupole LC/MS

Aplikace
| 2021 | Agilent Technologies
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Potraviny a zemědělství

Utilization of the ACQUITY PREMIER System and Column for Improved Oligonucleotide Bioanalytical Chromatographic Performance

Aplikace
| 2021 | Waters
Instrumentation
Consumables, LC/MS, LC/MS/MS, LC columns, LC/QQQ
Manufacturer
Waters
Industries
Klinická analýza

Development of Profiling Method for Major Lipids in Blood by Triple Quadrupole LC/MS/MS

Aplikace
| 2021 | Shimadzu
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Shimadzu
Industries
Klinická analýza
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use

LabRulez s.r.o., all rights reserved.