Simple, Standardized, and Sensitive Quantification of Bevacizumab (Avastin) Using ProteinWorks eXpress Digest Kits
Applications | 2016 | WatersInstrumentation
Consumables, LC/MS, LC/MS/MS, LC/QQQ
IndustriesProteomics
ManufacturerWaters
Key wordsheight, ftfsldtsk, peptide, proteinworks, bevacizumab, signature, dstyslsstltlsk, digest, express, unique, conc, mean, staylqmnslr, accuracy, rat, novice, kit, broadly, molecule, peptides, bioanalysis, plasma, blank, protein, generic, stayqmnslr, quantification, achieved, alhnhytqkslslspgk, alqsgnsqesvteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec, diqmtqspsslsasvgdrvtitcsasqdisnylnwyqqkpgkapkvliyftsslhsgvpsrfsgsgsgtdftltis, dyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkvepkscdkth, evqlvesggglvqpggslrlscaasgytftnygmnwvrqapgkglewvgwintytgeptyaadfkrrftfsldtsk, ntqpimdtdgsyfvysk, reemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhe, rvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlpps, slqpedfatyycqqystvpwtfgqgtkveikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdn, staylqmnslraedtavyycakyphyygsshwyfdvwgqgtlvtvssastkgpsvfplapsskstsggtalgclvk, tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynsty, vegf, using, applicable, adjunct, chain, nebuliser, endothelial, studies, flow, vascular, successfully
Similar PDF
Waters Application Notes - ProteinWorks
2016|Waters|Guides
Waters Application Notes ProteinWorks OUR SCIENTISTS Erin E. Chambers As a principal scientist, Erin has been working almost exclusively on peptide and protein bioanalysis for the last seven years, while managing small and large molecule bioanalysis and clinical research applications…
Key words
proteinworks, proteinworksdigest, digestexpress, expressarea, areapeptide, peptidekit, kitgeneric, generictrastuzumab, trastuzumabplasma, plasmadigestion, digestionftfsldtsk, ftfsldtskmurine, murineantibody, antibodyprotein, proteinsignature
A Generic Kit-Based Approach for Quantifying Monoclonal Antibody Drugs Through Direct Digestion of Discovery Study Samples
2015|Waters|Applications
A Generic Kit-Based Approach for Quantifying Monoclonal Antibody Drugs Through Direct Digestion of Discovery Study Samples Mary Lame, Hua Yang, Sherri Naughton, and Erin Chambers Waters Corporation, Milford, MA, USA A P P L I C AT I O N…
Key words
generic, genericsignature, signaturehrough, hroughkit, kitapytfgqgtk, apytfgqgtkbevacizumab, bevacizumabsinsathyaesvk, sinsathyaesvkftfsldtsk, ftfsldtskmonoclonal, monoclonalantibody, antibodyftisadtsk, ftisadtskproteinworks, proteinworksquantifying, quantifyingdirect, directdiscovery
PEPTIDE AND PROTEIN BIOANALYSIS
2016|Waters|Guides
[ APPLICATION NOTEBOOK ] PEPTIDE AND PROTEIN BIOANALYSIS [ OUR SCIENTISTS ] Yun Alelyunas, PhD Before coming to Waters in 2012, Yun Alelyunas was a principal scientist and team leader at AstraZeneca for 20 years where she was involved in…
Key words
ionkey, ionkeypeptide, peptideplasma, plasmaquantification, quantificationhuman, humanxevo, xevoarea, areainsulin, insulinuplc, uplcprotein, proteinpeptides, peptidesmrm, mrmproteinworks, proteinworksantibody, antibodyusing
A Universal, Optimized SPE Protocol for Clean-up of Tryptic Peptides in Protein Bioanalysis
2015|Waters|Applications
A Universal, Optimized SPE Protocol for Clean-up of Tryptic Peptides in Protein Bioanalysis Mary Lame, Hua Yang, Sherri Naughton, and Erin Chambers G OA L As of 2013, there were 338 new monoclonal antibody To demonstrate the performance of an…
Key words
spe, speproteinworks, proteinworksdigest, digestµelution, µelutionmurine, murineigg, iggprotein, proteinaffinity, affinityhumira, humirageneric, genericpeptides, peptidesplasma, plasmaclean, cleankit, kittryptic