A Universal, Optimized SPE Protocol for Clean-up of Tryptic Peptides in Protein Bioanalysis

Applications | 2015 | WatersInstrumentation
Sample Preparation, Consumables
Industries
Proteomics
Manufacturer
Waters

Summary

Significance of the Topic


The rapid expansion of monoclonal antibody therapeutics has driven the need for robust protein bioanalysis workflows. Cleanup of tryptic peptides prior to LC-MS quantification is essential to minimize matrix effects, enhance sensitivity, and maintain system robustness.

Goals and Overview of the Study


This work aimed to develop and validate a universal SPE protocol for post-digest clean-up of tryptic peptides across a range of monoclonal antibodies. The performance of the ProteinWorks µElution SPE Clean-up Kit was evaluated using 17 signature peptides from antibody drugs (e.g., Herceptin, Humira) and a murine internal standard.

Methodology and Instrumentation


Sample preparation utilized the Oasis MCX 96-well µElution plate, exploiting mixed-mode cation exchange to retain positively charged tryptic peptides.
  • Signature peptides: 17 sequences varying in molecular weight (969–1966 Da) and pI (4.1–9.7).
  • Loading guidelines: maximum 1.25 mg total protein per plate; minimum loading volume 15–25 µL.
  • Processing: plate format enabled elution in 25 µL without evaporation; entire 96-well plate processed in under 20 minutes via vacuum or positive pressure; amenable to automation.
  • Detection: peptides analyzed by MRM LC-MS to assess recovery and purity.

Main Results and Discussion


  • Average recovery for mAb peptides: 104%; murine internal standard: 84%.
  • Optimized sample loading volumes were established based on starting plasma volumes (15–70 µL) to achieve maximal sensitivity.
  • Cleanup effectively removed excess digestion reagents, phospholipids, and proteins, yielding high chromatographic purity.

Benefits and Practical Applications of the Method


  • Enhances sensitivity by reducing matrix interferences and concentrating extracts without evaporation losses.
  • Simplifies workflow with rapid 96-well processing and minimal hands-on time.
  • Supports reproducible low-level quantification of therapeutic proteins in plasma/serum.
  • Accessible to users with varied expertise in large-molecule bioanalysis.

Future Trends and Applications


The approach can be extended to diverse proteomics and biomarker studies. Further development may include integration with automated liquid-handling systems, exploration of novel mixed-mode sorbents for ultra-polar peptides, and miniaturized formats for high-throughput screening.

Conclusion


The optimized µElution SPE protocol provides a high-throughput, high-recovery solution for tryptic peptide cleanup in monoclonal antibody bioanalysis, balancing specificity, sensitivity, and automation compatibility.

References


  • Medicines in Development: Biologics, PhRMA report, 2013.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Waters Application Notes - ProteinWorks
Waters Application Notes ProteinWorks OUR SCIENTISTS Erin E. Chambers As a principal scientist, Erin has been working almost exclusively on peptide and protein bioanalysis for the last seven years, while managing small and large molecule bioanalysis and clinical research applications…
Key words
proteinworks, proteinworksdigest, digestexpress, expressarea, areapeptide, peptidekit, kitgeneric, generictrastuzumab, trastuzumabplasma, plasmaftfsldtsk, ftfsldtskdigestion, digestionmurine, murineantibody, antibodyprotein, proteindstyslsstltlsk
ProteinWorks - TAKE THE COMPLEXITY OUT OF LARGE MOLECULE QUANTIFICATION
ProteinWorks TA K E T H E COM P L EX IT Y OU T O F LA RG E MO L ECU L E QUANT IFICAT ION As the therapeutic and research landscape changes from small molecule to large…
Key words
proteinworks, proteinworkskit, kitexpress, expressdigest, digestavastin, avastinftfsldtsk, ftfsldtskplasma, plasmainter, interstaylqmnslr, staylqmnslrdstyslsstltlsk, dstyslsstltlskgpsvfplapssk, gpsvfplapsskµelution, µelutiondirect, directpeptide, peptideclean
Sensitive and Reproducible LC-MS Quantification of C-Reactive Protein in Plasma: A Potential Biomarker of Inflammation
[ APPLICATION NOTE ] Sensitive and Reproducible LC-MS Quantification of C-Reactive Protein in Plasma: A Potential Biomarker of Inflammation Paula Orens, Mary Lame, Steven Calciano, and Erin Chambers Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION High sensitivity quantification of…
Key words
esdtsyvslk, esdtsyvslkcrp, crpafvpfk, afvpfkafvfpk, afvfpkconcentration, concentrationpeptide, peptideendogenous, endogenousgysifsyatk, gysifsyatkmean, meanxevo, xevoplasma, plasmacalculated, calculatedoverspike, overspikeconfirmatory, confirmatorynote
Automated, Kit-Based Sample Preparation Strategy for  LC-MS Quantification of Cetuximab in Rat Plasma
[ APPLICATION NOTE ] Automated, Kit-Based Sample Preparation Strategy for LC-MS Quantification of Cetuximab in Rat Plasma Paula Orens, Mary Lame, and Steven Calciano Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION Automated and standardized approach In 2015, the global…
Key words
cetuximab, cetuximabsqvffk, sqvffkdtlmisr, dtlmisrdilltqspvilsvspger, dilltqspvilsvspgerttppvldsdgsfflysk, ttppvldsdgsfflyskalpapiek, alpapiekyasesisgipsr, yasesisgipsrgpsvfplapssk, gpsvfplapsskproteinworks, proteinworkssilumab, silumabpark, parkpeptides, peptidessignature, signaturetryptic, trypticdigest
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike