A Universal, Optimized SPE Protocol for Clean-up of Tryptic Peptides in Protein Bioanalysis
Applications | 2015 | WatersInstrumentation
Sample Preparation, Consumables
IndustriesProteomics
ManufacturerWaters
Key wordsspe, proteinworks, digest, µelution, murine, igg, protein, affinity, humira, generic, peptides, plasma, clean, kit, tryptic, binding, peptide, molecule, avastin, remicade, supernatant, human, herceptin, purification, digestion, small, total, exchange, during, digested, ntqpimdtdgsyfvysk, vnsaafpapiek, mnslqtddtak, nslylqmnslr, svselpimhqdwlngk, serum, verification, target, staylqmnslr, unpurified, starting, nylawyqqkpgk, apytfgqgtk, lbas, loading, dilltqspailsvspger, sinsathyaesvk, ftfsldtsk, dtyihwvr, larger
Similar PDF
Waters Application Notes - ProteinWorks
2016|Waters|Guides
Waters Application Notes ProteinWorks OUR SCIENTISTS Erin E. Chambers As a principal scientist, Erin has been working almost exclusively on peptide and protein bioanalysis for the last seven years, while managing small and large molecule bioanalysis and clinical research applications…
Key words
proteinworks, proteinworksdigest, digestexpress, expressarea, areapeptide, peptidetrastuzumab, trastuzumabgeneric, generickit, kitplasma, plasmaftfsldtsk, ftfsldtskdigestion, digestionmurine, murineantibody, antibodyprotein, proteinsignature
ProteinWorks - TAKE THE COMPLEXITY OUT OF LARGE MOLECULE QUANTIFICATION
2016|Waters|Brochures and specifications
ProteinWorks TA K E T H E COM P L EX IT Y OU T O F LA RG E MO L ECU L E QUANT IFICAT ION As the therapeutic and research landscape changes from small molecule to large…
Key words
proteinworks, proteinworkskit, kitexpress, expressdigest, digestavastin, avastinftfsldtsk, ftfsldtskplasma, plasmainter, interstaylqmnslr, staylqmnslrdstyslsstltlsk, dstyslsstltlskgpsvfplapssk, gpsvfplapsskµelution, µelutiondirect, directpeptide, peptideclean
Sensitive and Reproducible LC-MS Quantification of C-Reactive Protein in Plasma: A Potential Biomarker of Inflammation
2016|Waters|Applications
[ APPLICATION NOTE ] Sensitive and Reproducible LC-MS Quantification of C-Reactive Protein in Plasma: A Potential Biomarker of Inflammation Paula Orens, Mary Lame, Steven Calciano, and Erin Chambers Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION High sensitivity quantification of…
Key words
esdtsyvslk, esdtsyvslkcrp, crpafvpfk, afvpfkafvfpk, afvfpkconcentration, concentrationpeptide, peptideendogenous, endogenousgysifsyatk, gysifsyatkmean, meanxevo, xevoplasma, plasmacalculated, calculatedoverspike, overspikeconfirmatory, confirmatorynote
Automated, Kit-Based Sample Preparation Strategy for LC-MS Quantification of Cetuximab in Rat Plasma
2018|Waters|Applications
[ APPLICATION NOTE ] Automated, Kit-Based Sample Preparation Strategy for LC-MS Quantification of Cetuximab in Rat Plasma Paula Orens, Mary Lame, and Steven Calciano Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION Automated and standardized approach In 2015, the global…
Key words
cetuximab, cetuximabsqvffk, sqvffkdtlmisr, dtlmisrdilltqspvilsvspger, dilltqspvilsvspgerttppvldsdgsfflysk, ttppvldsdgsfflyskalpapiek, alpapiekyasesisgipsr, yasesisgipsrgpsvfplapssk, gpsvfplapsskproteinworks, proteinworkssilumab, silumabpeptides, peptidespark, parksignature, signaturetryptic, trypticdigest