Sensitive and Reproducible LC-MS Quantification of C-Reactive Protein in Plasma: A Potential Biomarker of Inflammation

Applications | 2016 | WatersInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
Industries
Clinical Research
Manufacturer
Waters

Summary

Significance of the Topic


C-reactive protein (CRP) is a key inflammatory biomarker with low baseline plasma levels in healthy individuals and dramatic elevation in response to tissue injury and chronic disease. Accurate quantification of CRP supports diagnosis and monitoring of rheumatoid arthritis, cardiovascular risk, and cancer-related inflammatory processes. Conventional immunoassays face limitations in specificity, dynamic range, and reproducibility, driving interest in LC–MS as a sensitive and standardized alternative for protein quantification.

Objectives and Study Overview


This study evaluates a rapid, kit-based LC–MS workflow for quantifying endogenous CRP in human and rat plasma. The goals were to reduce digestion time from 24 hours to 2 hours, simplify sample preparation without affinity enrichment, achieve low limits of quantification (LLOQs of 0.025–0.1 µg/mL from 35 µL plasma), and demonstrate reproducible calibration over four orders of magnitude.

Methodology and Instrumentation


Plasma samples (35 µL) spiked with human CRP were digested using the ProteinWorks eXpress Direct Digest Kit (abbreviated 5 min denaturation, 2 h tryptic digestion) followed by mixed-mode µElution SPE cleanup (Oasis MCX) to remove salts, lipids, and excess reagents. Tryptic peptides AFVPFK, ESDTSYVSLK and GYSIFSYATK were selected in silico using Skyline and monitored by MRM.
  • Column: ACQUITY UPLC HSS T3, 1.8 µm, 2.1 × 50 mm; 55 °C.
  • LC mobile phase: 0.1% formic acid in H2O (A) and acetonitrile (B), gradient 100–10% A over 6.4 min.
  • Mass spectrometer: Xevo TQ-XS triple quadrupole, ESI+, optimized cone (35 V) and collision energies for primary and confirmatory transitions.
  • Software: MassLynx v4.1 and TargetLynx for data acquisition and quantification.

Main Results and Discussion


The Xevo TQ-XS platform delivered 1.4–3.5× higher signal-to-noise ratios compared to the previous generation, lowering LLOQs to 0.025–0.05 µg/mL. Recoveries for all three peptides exceeded 90% with SPE cleanup. Calibration curves in rat and human plasma were linear over 0.025–100 µg/mL (R2 > 0.997) with 1/x or 1/x2 weighting. QC samples across four plasma lots showed mean accuracies of 89–106% and RSDs < 5%. Endogenous CRP levels in human plasma lots ranged from 0.39 to 18.13 µg/mL, confirmed by primary and secondary MRM transitions.

Benefits and Practical Applications


  • Fast turnaround: < 3 h workflow from digestion to quantitation.
  • High sensitivity: sub-microgram per milliliter LLOQs in minimal sample volume.
  • Broad dynamic range: accurate quantification over four orders of magnitude.
  • Improved specificity: mixed-mode SPE reduces matrix interferences.
  • Reproducibility: standardized kits and protocols ensure consistent performance.

Future Trends and Opportunities


Advancements in high-throughput protein quantification by LC–MS will emphasize further miniaturization of sample preparation, automated platforms, and integration of isotope-labelled standards. Expanded biomarker multiplexing and standardized workflows may enable broader clinical adoption for inflammatory and disease monitoring.

Conclusion


This kit-based LC–MS method enables sensitive, reproducible, and high-throughput quantification of CRP in plasma without affinity enrichment. It offers a practical alternative to immunoassays, with rapid sample preparation, enhanced dynamic range, and robust performance across diverse plasma matrices.

Reference


  1. Wikipedia contributors. C-reactive protein, pentameric structure. Wikipedia, 2016.
  2. Kun E., et al. Proteomics 4(4):1175–1186, 2004. Quantification of c-reactive protein in rheumatoid arthritis by MRM-MS.
  3. Mayo Clinic. C-reactive protein test overview, 2014.
  4. Allin K.H., Nordestgaard B.G. Crit Rev Clin Lab Sci 48(4):155–170, 2011.
  5. Rezelia M., et al. EuPA Open Proteomics 3:68–75, 2014.
  6. Skyline software for targeted proteomics, MacCoss Lab, 2016.
  7. UniProt Consortium. UniProtKB P02741 (CRP_HUMAN), 2014.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
SENSITIVE AND REPRODUCIBLE LC-MS QUANTIFICATION OF C-REACTIVE PROTEIN IN PLASMA FOR CLINICAL RESEARCH
SENSITIVE AND REPRODUCIBLE LC-MS QUANTIFICATION OF C-REACTIVE PROTEIN IN PLASMA FOR CLINICAL RESEARCH Paula Orens, Mary Lame, Steven Calciano, and Erin Chambers Waters Corporation 34 Maple Street Milford, MA 01757 RESULTS INTRODUCTION Curve (µg/mL) Weighting Linear Fit (R2) % Accuracy…
Key words
esdtsyvslk, esdtsyvslkcrp, crppeptide, peptidearea, areaafvfpk, afvfpkplasma, plasmaendogenous, endogenouschannelses, channelsesgysifsyatk, gysifsyatkesd, esddigestion, digestiontryptic, trypticafv, afvafvpfk, afvpfklots
PEPTIDE AND PROTEIN BIOANALYSIS
[ APPLICATION NOTEBOOK ] PEPTIDE AND PROTEIN BIOANALYSIS [ OUR SCIENTISTS ] Yun Alelyunas, PhD Before coming to Waters in 2012, Yun Alelyunas was a principal scientist and team leader at AstraZeneca for 20 years where she was involved in…
Key words
ionkey, ionkeypeptide, peptideplasma, plasmaquantification, quantificationhuman, humanarea, areaxevo, xevoinsulin, insulinuplc, uplcprotein, proteinmrm, mrmpeptides, peptidesproteinworks, proteinworksantibody, antibodyusing
Automated, Kit-Based Sample Preparation Strategy for  LC-MS Quantification of Cetuximab in Rat Plasma
[ APPLICATION NOTE ] Automated, Kit-Based Sample Preparation Strategy for LC-MS Quantification of Cetuximab in Rat Plasma Paula Orens, Mary Lame, and Steven Calciano Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION Automated and standardized approach In 2015, the global…
Key words
cetuximab, cetuximabsqvffk, sqvffkdtlmisr, dtlmisrdilltqspvilsvspger, dilltqspvilsvspgerttppvldsdgsfflysk, ttppvldsdgsfflyskalpapiek, alpapiekyasesisgipsr, yasesisgipsrgpsvfplapssk, gpsvfplapsskproteinworks, proteinworkssilumab, silumabpeptides, peptidespark, parksignature, signaturetryptic, trypticdigest
Amyloid Beta Peptides Quantification by SPE-LC-MS/MS with Automated Sample Preparation for Preclinical Research and Biomarker Discovery
[ APPLICATION NOTE ] Amyloid Beta Peptides Quantification by SPE-LC-MS/MS with Automated Sample Preparation for Preclinical Research and Biomarker Discovery Jaime Salcedo, 1 Philip Lambert,1 Leanne Davey,1 Mary Lame, 2 Caitlin Dunning, 2 Erin Chambers 2 Waters Corporation, Wexford, Ireland;…
Key words
amyloid, amyloidspe, spepeptides, peptideshcsf, hcsfmcx, mcxoasis, oasisquantification, quantificationprime, primetic, ticsample, samplepeptide, peptideendogenous, endogenouspreparation, preparationbeta, betaxevo
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike