Quantification of the Antibody Drug Conjugate, Trastuzumab Emtansine, and the Monocolonal Antibody, Trastuzumab, in Plasma Using a Generic Kit-Based Approach

Applications | 2016 | WatersInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
Industries
Clinical Research
Manufacturer
Waters

Summary

Importance of the Topic


Monoclonal antibodies (mAbs) and antibody–drug conjugates (ADCs) have become critical therapeutic agents due to their target specificity and potency while minimizing systemic toxicity. Robust quantification of these biotherapeutics in biological matrices is essential for pharmacokinetic, pharmacodynamic, and bioequivalence studies. Traditional ligand binding assays exhibit limitations in dynamic range, specificity, and reagent variability, driving the adoption of LC–MS methods. The development of streamlined, kit-based workflows addresses challenges in method complexity and reproducibility, enabling broader application of LC–MS in drug development.

Objectives and Study Overview


This study aimed to establish a standardized, generic kit-based approach for the accurate quantification of trastuzumab and its ADC derivative ado-trastuzumab emtansine (T-DM1) in rat plasma. Using the ProteinWorks eXpress Direct Digest Kit and a five-step digestion protocol, the work evaluated assay sensitivity, linearity, precision, and accuracy over a wide concentration range.

Methodology and Protocol


Plasma samples spiked with trastuzumab or T-DM1 (0.1–500 µg/mL) were directly digested (35 µL sample) following reduction and alkylation steps. A generic murine IgG served as internal standard. Peptide separation was performed on an ACQUITY UPLC Peptide BEH C18 column (2.1×150 mm, 1.7 µm) with a gradient elution (0.1% formic acid in water/acetonitrile) at 0.3 mL/min and column temperature 55 °C. Signature tryptic peptides (IYPTNGYTR, FTISADTSK, GPSVFPLAPSSK) were monitored by a Xevo TQ-S triple quadrupole in MRM mode.

Used Instrumentation


  • ACQUITY UPLC system
  • ACQUITY UPLC Peptide BEH C18, 300 Å, 1.7 µm, 2.1 × 150 mm column
  • Xevo TQ-S mass spectrometer with ESI+
  • MassLynx v4.1 software

Main Results and Discussion


The assay demonstrated linearity over 0.5–500 µg/mL with r2 >0.99 and lower limits of quantification of 0.5–1 µg/mL. Accuracy and precision met validation criteria (CV <8%, accuracy 90–110%). The lysine-free peptide IYPTNGYTR provided reliable quantification for both mAb and ADC due to absence of miscleavage issues. Lysine-containing peptides exhibited potential underestimation when drug loads blocked cleavage, illustrating the importance of peptide selection. Chromatograms confirmed stable retention and sensitive detection of signature peptides. Conjugated miscleavage peptides (FTISADTSKNTAYLQMNSLR, GPSVFPLAPSSKSTSGGTAALGCLVK) were detected and increased proportionally with T-DM1 concentration, enabling direct monitoring of payload occupancy.

Benefits and Practical Applications


  • Eliminates extensive method development via kit-based reagents and protocol
  • Supports multiplexed quantification of mAbs and ADCs
  • Extends dynamic range suitable for pharmacokinetic studies
  • Reduces assay variability with premeasured reagents

Future Trends and Potential Applications


Emerging workflows will integrate higher-throughput digestion platforms and advanced data analysis to support large-scale ADC drug screening. The approach can be adapted to diverse mAb–payload combinations and incorporated into automated bioanalytical pipelines. Multiplex quantification of multiple therapeutic antibodies in a single run and deeper characterization of ADC catabolites represent promising extensions.

Conclusions


The described generic kit-based LC–MS/MS workflow provides a simple, reproducible, and sensitive method for quantifying trastuzumab and T-DM1 in plasma. By leveraging streamlined digestion and robust MRM assays, the approach addresses key limitations of traditional immunoassays and facilitates timely decision-making in bioanalytical studies.

References


  1. Peddi PF, Hurvitz SA. Trastuzumab emtansine: the first targeted chemotherapy for treatment of breast cancer. Future Oncol. 2013;9(3):359–371.
  2. Barok M, Joensuu H, Isola J. Trastuzumab emtansine: mechanisms of action and drug resistance. Breast Cancer Res. 2014;16(2):209.
  3. DrugBank. Trastuzumab emtansine. Accessed online.
  4. FDA Guidance for Industry: Bioanalytical Method Validation. CDER.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Waters Application Notes - ProteinWorks
Waters Application Notes ProteinWorks OUR SCIENTISTS Erin E. Chambers As a principal scientist, Erin has been working almost exclusively on peptide and protein bioanalysis for the last seven years, while managing small and large molecule bioanalysis and clinical research applications…
Key words
proteinworks, proteinworksdigest, digestexpress, expressarea, areapeptide, peptidekit, kitgeneric, generictrastuzumab, trastuzumabplasma, plasmaftfsldtsk, ftfsldtskdigestion, digestionmurine, murineantibody, antibodyprotein, proteindstyslsstltlsk
PEPTIDE AND PROTEIN BIOANALYSIS
[ APPLICATION NOTEBOOK ] PEPTIDE AND PROTEIN BIOANALYSIS [ OUR SCIENTISTS ] Yun Alelyunas, PhD Before coming to Waters in 2012, Yun Alelyunas was a principal scientist and team leader at AstraZeneca for 20 years where she was involved in…
Key words
ionkey, ionkeypeptide, peptideplasma, plasmaquantification, quantificationhuman, humanarea, areaxevo, xevoinsulin, insulinuplc, uplcprotein, proteinmrm, mrmproteinworks, proteinworkspeptides, peptidesantibody, antibodyusing
Automated, Kit-Based Sample Preparation Strategy for  LC-MS Quantification of Cetuximab in Rat Plasma
[ APPLICATION NOTE ] Automated, Kit-Based Sample Preparation Strategy for LC-MS Quantification of Cetuximab in Rat Plasma Paula Orens, Mary Lame, and Steven Calciano Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION Automated and standardized approach In 2015, the global…
Key words
cetuximab, cetuximabsqvffk, sqvffkdtlmisr, dtlmisrdilltqspvilsvspger, dilltqspvilsvspgerttppvldsdgsfflysk, ttppvldsdgsfflyskalpapiek, alpapiekyasesisgipsr, yasesisgipsrgpsvfplapssk, gpsvfplapsskproteinworks, proteinworkssilumab, silumabpark, parkpeptides, peptidessignature, signaturetryptic, trypticdigest
Automating Sample Preparation Workflows for Hybrid LC-MS/MS Bioanalysis of Protein Therapeutics: Quantification of Etanercept  Using Affinity Purification and Digestion
[ APPLICATION NOTE ] Automating Sample Preparation Workflows for Hybrid LC-MS/MS Bioanalysis of Protein Therapeutics: Quantification of Etanercept Using Affinity Purification and Digestion Paula Orens and Mary Lame Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION Automating a hybrid LC-MS/MS…
Key words
protein, proteinautomating, automatingbioanalysis, bioanalysishybrid, hybridtherapeutics, therapeuticsautomated, automatedictcrpgwycalsk, ictcrpgwycalskworkflows, workflowsimmunoaffinity, immunoaffinitypreparation, preparationpurification, purificationetanercept, etanerceptmanual, manualnormalized, normalizedarea
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike