Quantification of the Antibody Drug Conjugate, Trastuzumab Emtansine, and the Monocolonal Antibody, Trastuzumab, in Plasma Using a Generic Kit-Based Approach
Applications | 2016 | WatersInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerWaters
Key wordstrastuzumab, rat, ftisadtsk, iyptngytr, gpsvfplapssk, plasma, blank, ftisadtskntaylqmnslr, peptide, mab, gpsvfplapsskstsggtaalgclvk, lysine, adc, proteinworks, time, mean, generic, signature, accuracy, express, igg, kit, digest, vnsaafpapiek, svselpimhqdwlngk, cautious, molecule, residue, dtyihwvr, quantify, nebuliser, peptides, uplc, murine, acquity, collision, broadly, drug, poses, direct, quantification, weighting, small, flow, conjugated, therapeutics, demonstration, terminal, confidently, desolvation
Similar PDF
Waters Application Notes - ProteinWorks
2016|Waters|Guides
Waters Application Notes ProteinWorks OUR SCIENTISTS Erin E. Chambers As a principal scientist, Erin has been working almost exclusively on peptide and protein bioanalysis for the last seven years, while managing small and large molecule bioanalysis and clinical research applications…
Key words
proteinworks, proteinworksdigest, digestexpress, expressarea, areapeptide, peptidetrastuzumab, trastuzumabkit, kitgeneric, genericplasma, plasmaftfsldtsk, ftfsldtskdigestion, digestionmurine, murineantibody, antibodyprotein, proteinsignature
PEPTIDE AND PROTEIN BIOANALYSIS
2016|Waters|Guides
[ APPLICATION NOTEBOOK ] PEPTIDE AND PROTEIN BIOANALYSIS [ OUR SCIENTISTS ] Yun Alelyunas, PhD Before coming to Waters in 2012, Yun Alelyunas was a principal scientist and team leader at AstraZeneca for 20 years where she was involved in…
Key words
ionkey, ionkeypeptide, peptideplasma, plasmaquantification, quantificationhuman, humanxevo, xevoarea, areainsulin, insulinprotein, proteinuplc, uplcmrm, mrmpeptides, peptidesproteinworks, proteinworksantibody, antibodyusing
Automated, Kit-Based Sample Preparation Strategy for LC-MS Quantification of Cetuximab in Rat Plasma
2018|Waters|Applications
[ APPLICATION NOTE ] Automated, Kit-Based Sample Preparation Strategy for LC-MS Quantification of Cetuximab in Rat Plasma Paula Orens, Mary Lame, and Steven Calciano Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION Automated and standardized approach In 2015, the global…
Key words
cetuximab, cetuximabsqvffk, sqvffkdtlmisr, dtlmisrdilltqspvilsvspger, dilltqspvilsvspgerttppvldsdgsfflysk, ttppvldsdgsfflyskalpapiek, alpapiekgpsvfplapssk, gpsvfplapsskyasesisgipsr, yasesisgipsrproteinworks, proteinworkssilumab, silumabpeptides, peptidespark, parksignature, signaturetryptic, trypticdigest
Automating Sample Preparation Workflows for Hybrid LC-MS/MS Bioanalysis of Protein Therapeutics: Quantification of Etanercept Using Affinity Purification and Digestion
2019|Waters|Applications
[ APPLICATION NOTE ] Automating Sample Preparation Workflows for Hybrid LC-MS/MS Bioanalysis of Protein Therapeutics: Quantification of Etanercept Using Affinity Purification and Digestion Paula Orens and Mary Lame Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION Automating a hybrid LC-MS/MS…
Key words
protein, proteinautomating, automatingbioanalysis, bioanalysishybrid, hybridtherapeutics, therapeuticsautomated, automatedictcrpgwycalsk, ictcrpgwycalskworkflows, workflowsimmunoaffinity, immunoaffinitypreparation, preparationpurification, purificationetanercept, etanerceptmanual, manualnormalized, normalizedcapture