Absolute Quantification of Yeast Kinases by LC/MS/MS using QconCAT and MRM Technologies
Applications | 2014 | WatersInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerWaters
Key wordsqconcat, copycat, yeast, xevo, kinases, quantification, mrm, absolute, peptide, cpc, technologies, proteins, peptides, transitions, using, type, settings, aviesensaer, iqnagtevveak, miscleave, elevated, nvndviapafvk, resolution, quantified, digestion, heavy, igdyagik, undetected, light, nanoacquity, quadrupole, native, protein, observed, whereby, were, skyline, equivalent, afforded, mass, scheduled, uplc, terminal, targetlynx, ainvasnlgapqqr, eplkdyykksgifgtvsgetsdiifrny, ettetdvvpiiqtpk, mxxr, qconcats, rqeiksestlgreattyiaqgkllpddlitrlitfrlsalgwlkpsamwl
Similar PDF
PEPTIDE AND PROTEIN BIOANALYSIS
2016|Waters|Guides
[ APPLICATION NOTEBOOK ] PEPTIDE AND PROTEIN BIOANALYSIS [ OUR SCIENTISTS ] Yun Alelyunas, PhD Before coming to Waters in 2012, Yun Alelyunas was a principal scientist and team leader at AstraZeneca for 20 years where she was involved in…
Key words
ionkey, ionkeypeptide, peptideplasma, plasmaquantification, quantificationhuman, humanarea, areaxevo, xevoinsulin, insulinprotein, proteinuplc, uplcpeptides, peptidesmrm, mrmproteinworks, proteinworksantibody, antibodyusing
High-Throughput LC-MS MRM Disease Protein Marker Verification Using the ionKey/MS System
2016|Waters|Applications
High-Throughput LC-MS MRM Disease Protein Marker Verification Using the ionKey/MS System Chris Hughes, Lee Gethings, Hans Vissers, and Jim Langridge Waters Corporation, Manchester, United Kingdom A P P L I C AT I O N B E N E F…
Key words
ionkey, ionkeymarker, markerhroughput, hroughputprotein, proteinmrm, mrmverification, verificationdisease, diseaseanhydrase, anhydrasecyclophilin, cyclophilincarbonic, carboniccatalase, catalasesystem, systemnanoacquity, nanoacquitypeptide, peptideuplc
MRM Quantification of Chitotriosidase in Human Plasma
2009|Waters|Applications
M R M Q ua n t i f i c at i o n o f C h i t o t r i o s i da s e i n H u m a n P l…
Key words
chitotriosidase, chitotriosidaseactivity, activitymrm, mrmexperiments, experimentsgaucher, gaucherbased, basedwere, werepatients, patientspeptides, peptidesenzyme, enzymenanoacquity, nanoacquityapplied, appliedassay, assaypatient, patientbiochemical
ionkey/MS - APPLICATION COMPENDIUM
2016|Waters|Guides
[ ion key / MS ] APPLICATION COMPENDIUM Dear Colleague, The 2014 introduction of the ionKey/MS System was a turning point for LC-MS. The promise of increased levels of sensitivity from smaller sample sizes was finally a reality. We were…
Key words
ionkey, ionkeyikey, ikeyuplc, uplcsystem, systemplasma, plasmasensitivity, sensitivityhuman, humanion, ionusing, usingmobility, mobilityarea, areadevice, deviceassay, assayseparation, separationquantification