Characterization of Glycosylation in the Fc Region of Therapeutic Recombinant Monoclonal Antibody | LabRulez LCMS
 

Similar PDF

Toggle
N-Glycan analysis of monoclonalantibodies and other glycoproteinsusing UHPLC with fluorescencedetectionAgilent 1260 Infinity Bio-inert QuaternaryLC System with Agilent 1260 InfinityFluorescence DetectorApplication NoteBiopharmaceuticalsLUAuthorsG02000 0A 0G8 1317.49Sonja Schneider, Edgar Nägele6Agilent Technologies, Inc.4Waldbronn, Germany2G0F2100 0A 0G1463.55 (1,6) G1F(1,3) G1F2110 0A 0GG2FMan5 1625.602120 0A 0GMan51787.65741235.44G2FS12121...
Key words
glycan, glycanglycans, glycansglycosylation, glycosylationfluorescence, fluorescenceglycoproteins, glycoproteinsmonoclonal, monoclonalantibody, antibodylinked, linkedpngase, pngaseconalbumin, conalbuminpattern, patternglycoprofil, glycoprofilmabs, mabsovalbumin, ovalbuminqtof
BioPharma Applications CompendiumAGILENT APPLICATIONS FORBIOPHARMACEUTICAL DISCOVERY,DEVELOPMENT AND QA/QCssssPLAYRPLAYRQSMAYRQSM N NFSM N NFGHN NFGH MAXIMIZE DEVELOPMENTAND ENSURE QUALITYAs you move from biopharmaceutical discovery intodevelopment, your success depends on encountering asfew surprises as possible.Enjoy the confidence of knowing the exact state of yourbiomolecule...
Key words
monoclonal, monoclonalagilent, agilentantibody, antibodyprotein, proteinantibodies, antibodiesanalysis, analysisusing, usingglycan, glycanelectrophoresis, electrophoresissolutions, solutionsmapping, mappingpeptide, peptidebio, biozorbax, zorbaxcharacterization
Prepping Biosimilars
2014|Agilent Technologies|Brochures and specifications
E-BOOK SERIESPreppingBiosimilarsFOR A BIG PLAYGlycanAnalysisAffinityChromatographyCharacterization /Quality ControlReversedPhase LCSponsored by G0FMan5TOGETHER. IT’S HOW WE WORK. IT’S HOW WE SUCCEED. CHARACTERIZETOGETHERWITH AGILENT BIOPHARMA ANALYSIS SOLUTIONSBiopharma workflows have become increasingly complex, labor intensive, andtime consuming. How can you speed up complex biopharma workflows and bemore...
Key words
prepping, preppingbiosimilars, biosimilarsoriginator, originatorbig, bigbiosimilar, biosimilarplay, playherceptin, herceptinmab, mabreversed, reversedcharacterization, characterizationaffinity, affinityglycan, glycanintact, intactpeptide, peptidecell
High Resolution GlycopeptideMapping of EPO Using an AgilentAdvanceBio Peptide MappingColumnApplication NoteBioPharmaAuthorsAbstractJames Martosella, Phu Duong, andThe 2.7 µm Agilent AdvanceBio Peptide Mapping column is specifically designed toAlex Zhuimprove separations of peptide and peptide mapping applications. The column isAgilent Technologies, Inc.based on...
Key words
rhepo, rhepovysnflr, vysnflrmapping, mappingeaenittgcaehcslnenitvpdtkvnfyawk, eaenittgcaehcslnenitvpdtkvnfyawkvnfyawkr, vnfyawkrpeptide, peptidelfrvysnflr, lfrvysnflrvysnflrgk, vysnflrgkvlerylleakeaenittgcaehcslnenitvpdtk, vlerylleakeaenittgcaehcslnenitvpdtkvnfyawk, vnfyawkadvancebio, advancebioeaenittgcaehcslnenitvpdtkvnfyawkr, eaenittgcaehcslnenitvpdtkvnfyawkrvysnflrgklk, vysnflrgklkylleakeaenittgcaehcslnenitvpdtkvnfyawk, ylleakeaenittgcaehcslnenitvpdtkvnfyawkglycopeptide
 

Similar PDF

Toggle
N-Glycan analysis of monoclonalantibodies and other glycoproteinsusing UHPLC with fluorescencedetectionAgilent 1260 Infinity Bio-inert QuaternaryLC System with Agilent 1260 InfinityFluorescence DetectorApplication NoteBiopharmaceuticalsLUAuthorsG02000 0A 0G8 1317.49Sonja Schneider, Edgar Nägele6Agilent Technologies, Inc.4Waldbronn, Germany2G0F2100 0A 0G1463.55 (1,6) G1F(1,3) G1F2110 0A 0GG2FMan5 1625.602120 0A 0GMan51787.65741235.44G2FS12121...
Key words
glycan, glycanglycans, glycansglycosylation, glycosylationfluorescence, fluorescenceglycoproteins, glycoproteinsmonoclonal, monoclonalantibody, antibodylinked, linkedpngase, pngaseconalbumin, conalbuminpattern, patternglycoprofil, glycoprofilmabs, mabsovalbumin, ovalbuminqtof
BioPharma Applications CompendiumAGILENT APPLICATIONS FORBIOPHARMACEUTICAL DISCOVERY,DEVELOPMENT AND QA/QCssssPLAYRPLAYRQSMAYRQSM N NFSM N NFGHN NFGH MAXIMIZE DEVELOPMENTAND ENSURE QUALITYAs you move from biopharmaceutical discovery intodevelopment, your success depends on encountering asfew surprises as possible.Enjoy the confidence of knowing the exact state of yourbiomolecule...
Key words
monoclonal, monoclonalagilent, agilentantibody, antibodyprotein, proteinantibodies, antibodiesanalysis, analysisusing, usingglycan, glycanelectrophoresis, electrophoresissolutions, solutionsmapping, mappingpeptide, peptidebio, biozorbax, zorbaxcharacterization
Prepping Biosimilars
2014|Agilent Technologies|Brochures and specifications
E-BOOK SERIESPreppingBiosimilarsFOR A BIG PLAYGlycanAnalysisAffinityChromatographyCharacterization /Quality ControlReversedPhase LCSponsored by G0FMan5TOGETHER. IT’S HOW WE WORK. IT’S HOW WE SUCCEED. CHARACTERIZETOGETHERWITH AGILENT BIOPHARMA ANALYSIS SOLUTIONSBiopharma workflows have become increasingly complex, labor intensive, andtime consuming. How can you speed up complex biopharma workflows and bemore...
Key words
prepping, preppingbiosimilars, biosimilarsoriginator, originatorbig, bigbiosimilar, biosimilarplay, playherceptin, herceptinmab, mabreversed, reversedcharacterization, characterizationaffinity, affinityglycan, glycanintact, intactpeptide, peptidecell
High Resolution GlycopeptideMapping of EPO Using an AgilentAdvanceBio Peptide MappingColumnApplication NoteBioPharmaAuthorsAbstractJames Martosella, Phu Duong, andThe 2.7 µm Agilent AdvanceBio Peptide Mapping column is specifically designed toAlex Zhuimprove separations of peptide and peptide mapping applications. The column isAgilent Technologies, Inc.based on...
Key words
rhepo, rhepovysnflr, vysnflrmapping, mappingeaenittgcaehcslnenitvpdtkvnfyawk, eaenittgcaehcslnenitvpdtkvnfyawkvnfyawkr, vnfyawkrpeptide, peptidelfrvysnflr, lfrvysnflrvysnflrgk, vysnflrgkvlerylleakeaenittgcaehcslnenitvpdtk, vlerylleakeaenittgcaehcslnenitvpdtkvnfyawk, vnfyawkadvancebio, advancebioeaenittgcaehcslnenitvpdtkvnfyawkr, eaenittgcaehcslnenitvpdtkvnfyawkrvysnflrgklk, vysnflrgklkylleakeaenittgcaehcslnenitvpdtkvnfyawk, ylleakeaenittgcaehcslnenitvpdtkvnfyawkglycopeptide
 

Related content

Simultaneous analysis of drug substances according to USP assay and impurity methods

Applications
| 2022 | Thermo Fischer Scientific
Instrumentation
HPLC
Manufacturer
Thermo Fischer Scientific
Industries
Pharma & Biopharma

Matrix Matching or Isotope Dilution? A Comparison of Two Quantitation Approaches to Determine PFAS in Dairy Milk

Applications
| 2022 | Waters
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Waters
Industries
Food & Agriculture

Food Metabolomics of Alcoholic Beverage Using Single-Quadrupole Mass Spectrometer — Oligosaccharide and Polysaccharide Profiling —

Applications
| 2022 | Shimadzu
Instrumentation
LC/MS, LC/SQ
Manufacturer
Shimadzu
Industries
Food & Agriculture

Demonstrating the Applicability of the ACQUITY™ Premier Binary System for Long Shallow Gradient Peptide Mapping Analysis

Applications
| 2022 | Waters
Instrumentation
HPLC
Manufacturer
Waters
Industries
Proteomics

Qualitative Analysis of the Components in Foods Using DART and the Quadrupole Time- of-flight Mass Spectrometer

Applications
| 2022 | Shimadzu
Instrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, DART
Manufacturer
Shimadzu
Industries
Food & Agriculture
 

Related content

Simultaneous analysis of drug substances according to USP assay and impurity methods

Applications
| 2022 | Thermo Fischer Scientific
Instrumentation
HPLC
Manufacturer
Thermo Fischer Scientific
Industries
Pharma & Biopharma

Matrix Matching or Isotope Dilution? A Comparison of Two Quantitation Approaches to Determine PFAS in Dairy Milk

Applications
| 2022 | Waters
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Waters
Industries
Food & Agriculture

Food Metabolomics of Alcoholic Beverage Using Single-Quadrupole Mass Spectrometer — Oligosaccharide and Polysaccharide Profiling —

Applications
| 2022 | Shimadzu
Instrumentation
LC/MS, LC/SQ
Manufacturer
Shimadzu
Industries
Food & Agriculture

Demonstrating the Applicability of the ACQUITY™ Premier Binary System for Long Shallow Gradient Peptide Mapping Analysis

Applications
| 2022 | Waters
Instrumentation
HPLC
Manufacturer
Waters
Industries
Proteomics

Qualitative Analysis of the Components in Foods Using DART and the Quadrupole Time- of-flight Mass Spectrometer

Applications
| 2022 | Shimadzu
Instrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, DART
Manufacturer
Shimadzu
Industries
Food & Agriculture
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use

LabRulez s.r.o., all rights reserved.