Characterization of Glycosylation in the Fc Region of Therapeutic Recombinant Monoclonal AntibodyApplications | 2017 | Agilent TechnologiesInstrumentation
HPLC, LC/TOF, LC/HRMS, LC/MS
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies
Key words

 

Similar PDF

Toggle
Agilent BioHPLC ColumnsCharacterization of NIST MonoclonalAntibody Critical Quality AttributesApplication Compendium ContentsAgilent-NISTmAb Standard (P/N 5191-5744; 5191-5745) was aliquoted fromNISTmAb RM 8671 batch. Quality control (QC) testing is performed usingAgilent LC-MS system. QC batch release test includes aggregate profile, chargevariants and intact mass...
Key words
mab, mabglycan, glycanadvancebio, advancebiomapping, mappingpeptide, peptidecounts, countsmonoclonal, monoclonalagilent, agilentglycans, glycansmin, minprotein, proteinnistmab, nistmabmass, masscolumn, columnantibody
N-Glycan analysis of monoclonalantibodies and other glycoproteinsusing UHPLC with fluorescencedetectionAgilent 1260 Infinity Bio-inert QuaternaryLC System with Agilent 1260 InfinityFluorescence DetectorApplication NoteBiopharmaceuticalsLUAuthorsG02000 0A 0G8 1317.49Sonja Schneider, Edgar Nägele6Agilent Technologies, Inc.4Waldbronn, Germany2G0F2100 0A 0G1463.55 (1,6) G1F(1,3) G1F2110 0A 0GG2FMan5 1625.602120 0A 0GMan51787.65741235.44G2FS12121...
Key words
glycan, glycanglycans, glycansglycosylation, glycosylationfluorescence, fluorescenceglycoproteins, glycoproteinsmonoclonal, monoclonalantibody, antibodylinked, linkedpngase, pngaseconalbumin, conalbuminpattern, patternovalbumin, ovalbuminmabs, mabsglycoprofil, glycoprofilqtof
BioPharma Applications CompendiumAGILENT APPLICATIONS FORBIOPHARMACEUTICAL DISCOVERY,DEVELOPMENT AND QA/QCssssPLAYRPLAYRQSMAYRQSM N NFSM N NFGHN NFGH MAXIMIZE DEVELOPMENTAND ENSURE QUALITYAs you move from biopharmaceutical discovery intodevelopment, your success depends on encountering asfew surprises as possible.Enjoy the confidence of knowing the exact state of yourbiomolecule...
Key words
monoclonal, monoclonalagilent, agilentantibody, antibodyprotein, proteinantibodies, antibodiesanalysis, analysisusing, usingglycan, glycanelectrophoresis, electrophoresispeptide, peptidemapping, mappingsolutions, solutionsbio, biozorbax, zorbaxcharacterization
High Resolution GlycopeptideMapping of EPO Using an AgilentAdvanceBio Peptide MappingColumnApplication NoteBioPharmaAuthorsAbstractJames Martosella, Phu Duong, andThe 2.7 µm Agilent AdvanceBio Peptide Mapping column is specifically designed toAlex Zhuimprove separations of peptide and peptide mapping applications. The column isAgilent Technologies, Inc.based on...
Key words
rhepo, rhepovysnflr, vysnflrmapping, mappingeaenittgcaehcslnenitvpdtkvnfyawk, eaenittgcaehcslnenitvpdtkvnfyawkvnfyawkr, vnfyawkrpeptide, peptidelfrvysnflr, lfrvysnflrvysnflrgk, vysnflrgkvlerylleakeaenittgcaehcslnenitvpdtk, vlerylleakeaenittgcaehcslnenitvpdtkvnfyawk, vnfyawkadvancebio, advancebioeaenittgcaehcslnenitvpdtkvnfyawkr, eaenittgcaehcslnenitvpdtkvnfyawkrvysnflrgklk, vysnflrgklkylleakeaenittgcaehcslnenitvpdtkvnfyawk, ylleakeaenittgcaehcslnenitvpdtkvnfyawkdigest

Characterization of Glycosylation in the Fc Region of Therapeutic Recombinant Monoclonal AntibodyApplications | 2017 | Agilent TechnologiesInstrumentation
HPLC, LC/TOF, LC/HRMS, LC/MS
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies
Key words

 

Similar PDF

Toggle
Agilent BioHPLC ColumnsCharacterization of NIST MonoclonalAntibody Critical Quality AttributesApplication Compendium ContentsAgilent-NISTmAb Standard (P/N 5191-5744; 5191-5745) was aliquoted fromNISTmAb RM 8671 batch. Quality control (QC) testing is performed usingAgilent LC-MS system. QC batch release test includes aggregate profile, chargevariants and intact mass...
Key words
mab, mabglycan, glycanadvancebio, advancebiomapping, mappingpeptide, peptidecounts, countsmonoclonal, monoclonalagilent, agilentglycans, glycansmin, minprotein, proteinnistmab, nistmabmass, masscolumn, columnantibody
N-Glycan analysis of monoclonalantibodies and other glycoproteinsusing UHPLC with fluorescencedetectionAgilent 1260 Infinity Bio-inert QuaternaryLC System with Agilent 1260 InfinityFluorescence DetectorApplication NoteBiopharmaceuticalsLUAuthorsG02000 0A 0G8 1317.49Sonja Schneider, Edgar Nägele6Agilent Technologies, Inc.4Waldbronn, Germany2G0F2100 0A 0G1463.55 (1,6) G1F(1,3) G1F2110 0A 0GG2FMan5 1625.602120 0A 0GMan51787.65741235.44G2FS12121...
Key words
glycan, glycanglycans, glycansglycosylation, glycosylationfluorescence, fluorescenceglycoproteins, glycoproteinsmonoclonal, monoclonalantibody, antibodylinked, linkedpngase, pngaseconalbumin, conalbuminpattern, patternovalbumin, ovalbuminmabs, mabsglycoprofil, glycoprofilqtof
BioPharma Applications CompendiumAGILENT APPLICATIONS FORBIOPHARMACEUTICAL DISCOVERY,DEVELOPMENT AND QA/QCssssPLAYRPLAYRQSMAYRQSM N NFSM N NFGHN NFGH MAXIMIZE DEVELOPMENTAND ENSURE QUALITYAs you move from biopharmaceutical discovery intodevelopment, your success depends on encountering asfew surprises as possible.Enjoy the confidence of knowing the exact state of yourbiomolecule...
Key words
monoclonal, monoclonalagilent, agilentantibody, antibodyprotein, proteinantibodies, antibodiesanalysis, analysisusing, usingglycan, glycanelectrophoresis, electrophoresispeptide, peptidemapping, mappingsolutions, solutionsbio, biozorbax, zorbaxcharacterization
High Resolution GlycopeptideMapping of EPO Using an AgilentAdvanceBio Peptide MappingColumnApplication NoteBioPharmaAuthorsAbstractJames Martosella, Phu Duong, andThe 2.7 µm Agilent AdvanceBio Peptide Mapping column is specifically designed toAlex Zhuimprove separations of peptide and peptide mapping applications. The column isAgilent Technologies, Inc.based on...
Key words
rhepo, rhepovysnflr, vysnflrmapping, mappingeaenittgcaehcslnenitvpdtkvnfyawk, eaenittgcaehcslnenitvpdtkvnfyawkvnfyawkr, vnfyawkrpeptide, peptidelfrvysnflr, lfrvysnflrvysnflrgk, vysnflrgkvlerylleakeaenittgcaehcslnenitvpdtk, vlerylleakeaenittgcaehcslnenitvpdtkvnfyawk, vnfyawkadvancebio, advancebioeaenittgcaehcslnenitvpdtkvnfyawkr, eaenittgcaehcslnenitvpdtkvnfyawkrvysnflrgklk, vysnflrgklkylleakeaenittgcaehcslnenitvpdtkvnfyawk, ylleakeaenittgcaehcslnenitvpdtkvnfyawkdigest
 

Related content

It’s Not All About the Column: The Role of the Mobile Phase and Your Instrument

Presentations
| 2021 | Agilent Technologies
Instrumentation
Consumables, HPLC
Manufacturer
Agilent Technologies
Industries
---

Improved Separation of RNA Nucleotides, Nucleosides, and Nucleobases on Atlantis Premier BEH Z-HILIC Columns

Applications
| 2021 | Waters
Instrumentation
Consumables, LC/MS, LC/MS/MS, LC columns, LC/QQQ
Manufacturer
Waters
Industries
Clinical Research

Quantification of THC and CBD in Gummies and Hard Candies

Applications
| 2021 | Agilent Technologies
Instrumentation
HPLC, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Manufacturer
Agilent Technologies
Industries
Food & Agriculture

Detection and Quantitation of Nitrosamine Impurities in Drug Substances by LC-HRMS on LCMS-9030

Applications
| 2021 | Shimadzu
Instrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Manufacturer
Shimadzu
Industries
Pharma & Biopharma

Evaluating the Waters ACQUITY Premier System as a Flexible LC Platform That Can Be Broadly Deployed in Biopharmaceutical Labs

Applications
| 2021 | Waters
Instrumentation
HPLC, GPC/SEC
Manufacturer
Waters
Industries
Pharma & Biopharma
 

Related content

It’s Not All About the Column: The Role of the Mobile Phase and Your Instrument

Presentations
| 2021 | Agilent Technologies
Instrumentation
Consumables, HPLC
Manufacturer
Agilent Technologies
Industries
---

Improved Separation of RNA Nucleotides, Nucleosides, and Nucleobases on Atlantis Premier BEH Z-HILIC Columns

Applications
| 2021 | Waters
Instrumentation
Consumables, LC/MS, LC/MS/MS, LC columns, LC/QQQ
Manufacturer
Waters
Industries
Clinical Research

Quantification of THC and CBD in Gummies and Hard Candies

Applications
| 2021 | Agilent Technologies
Instrumentation
HPLC, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Manufacturer
Agilent Technologies
Industries
Food & Agriculture

Detection and Quantitation of Nitrosamine Impurities in Drug Substances by LC-HRMS on LCMS-9030

Applications
| 2021 | Shimadzu
Instrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Manufacturer
Shimadzu
Industries
Pharma & Biopharma

Evaluating the Waters ACQUITY Premier System as a Flexible LC Platform That Can Be Broadly Deployed in Biopharmaceutical Labs

Applications
| 2021 | Waters
Instrumentation
HPLC, GPC/SEC
Manufacturer
Waters
Industries
Pharma & Biopharma
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use

LabRulez s.r.o., all rights reserved.