Characterization of Glycosylation in the Fc Region of Therapeutic Recombinant Monoclonal Antibody | LabRulez LCMS_EN
 

Similar PDF

Toggle
N-Glycan analysis of monoclonalantibodies and other glycoproteinsusing UHPLC with fluorescencedetectionAgilent 1260 Infinity Bio-inert QuaternaryLC System with Agilent 1260 InfinityFluorescence DetectorApplication NoteBiopharmaceuticalsLUAuthorsG02000 0A 0G8 1317.49Sonja Schneider, Edgar Nägele6Agilent Technologies, Inc.4Waldbronn, Germany2G0F2100 0A 0G1463.55 (1,6) G1F(1,3) G1F2110 0A 0GG2FMan5 1625.602120 0A 0GMan51787.65741235.44G2FS12121...
Key words
glycan, glycanglycans, glycansglycosylation, glycosylationfluorescence, fluorescenceglycoproteins, glycoproteinsmonoclonal, monoclonalantibody, antibodylinked, linkedpngase, pngaseconalbumin, conalbuminpattern, patternglycoprofil, glycoprofilmabs, mabsovalbumin, ovalbuminqtof
BioPharma Applications CompendiumAGILENT APPLICATIONS FORBIOPHARMACEUTICAL DISCOVERY,DEVELOPMENT AND QA/QCssssPLAYRPLAYRQSMAYRQSM N NFSM N NFGHN NFGH MAXIMIZE DEVELOPMENTAND ENSURE QUALITYAs you move from biopharmaceutical discovery intodevelopment, your success depends on encountering asfew surprises as possible.Enjoy the confidence of knowing the exact state of yourbiomolecule...
Key words
monoclonal, monoclonalagilent, agilentantibody, antibodyprotein, proteinantibodies, antibodiesanalysis, analysisusing, usingglycan, glycanelectrophoresis, electrophoresismapping, mappingpeptide, peptidesolutions, solutionsbio, biozorbax, zorbaxcharacterization
Prepping Biosimilars
2014|Agilent Technologies|Brochures and specifications
E-BOOK SERIESPreppingBiosimilarsFOR A BIG PLAYGlycanAnalysisAffinityChromatographyCharacterization /Quality ControlReversedPhase LCSponsored by G0FMan5TOGETHER. IT’S HOW WE WORK. IT’S HOW WE SUCCEED. CHARACTERIZETOGETHERWITH AGILENT BIOPHARMA ANALYSIS SOLUTIONSBiopharma workflows have become increasingly complex, labor intensive, andtime consuming. How can you speed up complex biopharma workflows and bemore...
Key words
prepping, preppingbiosimilars, biosimilarsoriginator, originatorbig, bigbiosimilar, biosimilarplay, playherceptin, herceptinmab, mabreversed, reversedcharacterization, characterizationintact, intactaffinity, affinityglycan, glycanpeptide, peptidecell
High Resolution GlycopeptideMapping of EPO Using an AgilentAdvanceBio Peptide MappingColumnApplication NoteBioPharmaAuthorsAbstractJames Martosella, Phu Duong, andThe 2.7 µm Agilent AdvanceBio Peptide Mapping column is specifically designed toAlex Zhuimprove separations of peptide and peptide mapping applications. The column isAgilent Technologies, Inc.based on...
Key words
rhepo, rhepovysnflr, vysnflrmapping, mappingeaenittgcaehcslnenitvpdtkvnfyawk, eaenittgcaehcslnenitvpdtkvnfyawkvnfyawkr, vnfyawkrpeptide, peptidelfrvysnflr, lfrvysnflrvysnflrgk, vysnflrgkvlerylleakeaenittgcaehcslnenitvpdtk, vlerylleakeaenittgcaehcslnenitvpdtkvnfyawk, vnfyawkadvancebio, advancebioeaenittgcaehcslnenitvpdtkvnfyawkr, eaenittgcaehcslnenitvpdtkvnfyawkrvysnflrgklk, vysnflrgklkylleakeaenittgcaehcslnenitvpdtkvnfyawk, ylleakeaenittgcaehcslnenitvpdtkvnfyawkglycopeptide
 

Similar PDF

Toggle
N-Glycan analysis of monoclonalantibodies and other glycoproteinsusing UHPLC with fluorescencedetectionAgilent 1260 Infinity Bio-inert QuaternaryLC System with Agilent 1260 InfinityFluorescence DetectorApplication NoteBiopharmaceuticalsLUAuthorsG02000 0A 0G8 1317.49Sonja Schneider, Edgar Nägele6Agilent Technologies, Inc.4Waldbronn, Germany2G0F2100 0A 0G1463.55 (1,6) G1F(1,3) G1F2110 0A 0GG2FMan5 1625.602120 0A 0GMan51787.65741235.44G2FS12121...
Key words
glycan, glycanglycans, glycansglycosylation, glycosylationfluorescence, fluorescenceglycoproteins, glycoproteinsmonoclonal, monoclonalantibody, antibodylinked, linkedpngase, pngaseconalbumin, conalbuminpattern, patternglycoprofil, glycoprofilmabs, mabsovalbumin, ovalbuminqtof
BioPharma Applications CompendiumAGILENT APPLICATIONS FORBIOPHARMACEUTICAL DISCOVERY,DEVELOPMENT AND QA/QCssssPLAYRPLAYRQSMAYRQSM N NFSM N NFGHN NFGH MAXIMIZE DEVELOPMENTAND ENSURE QUALITYAs you move from biopharmaceutical discovery intodevelopment, your success depends on encountering asfew surprises as possible.Enjoy the confidence of knowing the exact state of yourbiomolecule...
Key words
monoclonal, monoclonalagilent, agilentantibody, antibodyprotein, proteinantibodies, antibodiesanalysis, analysisusing, usingglycan, glycanelectrophoresis, electrophoresismapping, mappingpeptide, peptidesolutions, solutionsbio, biozorbax, zorbaxcharacterization
Prepping Biosimilars
2014|Agilent Technologies|Brochures and specifications
E-BOOK SERIESPreppingBiosimilarsFOR A BIG PLAYGlycanAnalysisAffinityChromatographyCharacterization /Quality ControlReversedPhase LCSponsored by G0FMan5TOGETHER. IT’S HOW WE WORK. IT’S HOW WE SUCCEED. CHARACTERIZETOGETHERWITH AGILENT BIOPHARMA ANALYSIS SOLUTIONSBiopharma workflows have become increasingly complex, labor intensive, andtime consuming. How can you speed up complex biopharma workflows and bemore...
Key words
prepping, preppingbiosimilars, biosimilarsoriginator, originatorbig, bigbiosimilar, biosimilarplay, playherceptin, herceptinmab, mabreversed, reversedcharacterization, characterizationintact, intactaffinity, affinityglycan, glycanpeptide, peptidecell
High Resolution GlycopeptideMapping of EPO Using an AgilentAdvanceBio Peptide MappingColumnApplication NoteBioPharmaAuthorsAbstractJames Martosella, Phu Duong, andThe 2.7 µm Agilent AdvanceBio Peptide Mapping column is specifically designed toAlex Zhuimprove separations of peptide and peptide mapping applications. The column isAgilent Technologies, Inc.based on...
Key words
rhepo, rhepovysnflr, vysnflrmapping, mappingeaenittgcaehcslnenitvpdtkvnfyawk, eaenittgcaehcslnenitvpdtkvnfyawkvnfyawkr, vnfyawkrpeptide, peptidelfrvysnflr, lfrvysnflrvysnflrgk, vysnflrgkvlerylleakeaenittgcaehcslnenitvpdtk, vlerylleakeaenittgcaehcslnenitvpdtkvnfyawk, vnfyawkadvancebio, advancebioeaenittgcaehcslnenitvpdtkvnfyawkr, eaenittgcaehcslnenitvpdtkvnfyawkrvysnflrgklk, vysnflrgklkylleakeaenittgcaehcslnenitvpdtkvnfyawk, ylleakeaenittgcaehcslnenitvpdtkvnfyawkglycopeptide
 

Related content

Overcoming the challenges of liquid chromatography method transfer: A CDMO perspective

Technical notes
| 2022 | Thermo Fischer Scientific
Instrumentation
HPLC
Manufacturer
Thermo Fischer Scientific
Industries
---

Method for the determination of 431 Residual Pesticides in Honey using LCMS-8050 and GCMS-TQ8040 NX

Applications
| 2022 | Shimadzu
Instrumentation
GC/MSD, GC/MS/MS, GC/QQQ, LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Shimadzu
Industries
Food & Agriculture

ASMS: IMPROVEMENTS IN SENSITIVITY, QUANTITATIVE LINEARITY, AND ROBUSTNESS USING A MODIFIED BENCH-TOP QUADRUPOLE ORTHOGONAL TIME-OF-FLIGHT MASS SPECTROMETER (Q-TOF MS)

Posters
| 2022 | Waters
Instrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Manufacturer
Waters
Industries
---

Determination of Per and Polyfluoroalkyl Substances in Soils Using Carbon S SPE by LC/MS/MS

Applications
| 2022 | Agilent Technologies
Instrumentation
Sample Preparation, Consumables, LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Environmental

ASTM D4327-03 Compliant Analysis of Anions in Wastewater

Applications
| 2022 | Shimadzu
Instrumentation
Ion chromatography
Manufacturer
Shimadzu
Industries
Environmental
 

Related content

Overcoming the challenges of liquid chromatography method transfer: A CDMO perspective

Technical notes
| 2022 | Thermo Fischer Scientific
Instrumentation
HPLC
Manufacturer
Thermo Fischer Scientific
Industries
---

Method for the determination of 431 Residual Pesticides in Honey using LCMS-8050 and GCMS-TQ8040 NX

Applications
| 2022 | Shimadzu
Instrumentation
GC/MSD, GC/MS/MS, GC/QQQ, LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Shimadzu
Industries
Food & Agriculture

ASMS: IMPROVEMENTS IN SENSITIVITY, QUANTITATIVE LINEARITY, AND ROBUSTNESS USING A MODIFIED BENCH-TOP QUADRUPOLE ORTHOGONAL TIME-OF-FLIGHT MASS SPECTROMETER (Q-TOF MS)

Posters
| 2022 | Waters
Instrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Manufacturer
Waters
Industries
---

Determination of Per and Polyfluoroalkyl Substances in Soils Using Carbon S SPE by LC/MS/MS

Applications
| 2022 | Agilent Technologies
Instrumentation
Sample Preparation, Consumables, LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Environmental

ASTM D4327-03 Compliant Analysis of Anions in Wastewater

Applications
| 2022 | Shimadzu
Instrumentation
Ion chromatography
Manufacturer
Shimadzu
Industries
Environmental
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use

LabRulez s.r.o., all rights reserved.