High Resolution Glycopeptide Mapping of EPO Using an Agilent AdvanceBio Peptide Mapping Column
Applications | 2017 | Agilent TechnologiesInstrumentation
Consumables, LC/TOF, LC/HRMS, LC/MS, LC columns
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Key wordsrhepo, vysnflr, mapping, eaenittgcaehcslnenitvpdtkvnfyawk, vnfyawkr, peptide, lfrvysnflr, vysnflrgk, vlerylleakeaenittgcaehcslnenitvpdtk, vnfyawk, advancebio, eaenittgcaehcslnenitvpdtkvnfyawkr, vysnflrgklk, ylleakeaenittgcaehcslnenitvpdtkvnfyawk, glycopeptide, digest, recombinant, glyco, epo, erythropoietin, column, counts, chromatographic, eaenittgcaehcslnenitvpdtk, gqallvnssqpweplqlhvdkavsglr, lfrvysnflrgk, human, tryptic, stratagene, utility, min, agilent, pair, optimized, from, zhu, formic, advancedbio, creative, acquisition, profiling, mass, sequence, resolution, profile, conditions, alex, separations, burdick, separation
Similar PDF
Developing a Method to Protect the Integrity of Racing Using Targeted SRM: Detection and Quantitation of rhEPO/DPO in Horse Plasma
2016|Thermo Fischer Scientific|Applications
ApplicationNote: 408Developing a Method to Protect the Integrityof Racing Using Targeted SRM: Detection andQuantitation of rhEPO/DPO in Horse PlasmaScott M. Peterman1, Cornelius Uboh2, Fuyu Guan2,3, Lawrence Soma3, Eric Birks3, and Jinwen Chen3Thermo Fisher Scientific, Somerset, NJ, USA; 2Pennsylvania Equine Toxicology...
Key words
rhepo, rhepodpo, dpolabeled, labeledhorse, horseabundance, abundancepeptides, peptidesrelative, relativeplasma, plasmaalgaqkeais, algaqkeaisgklklytgea, gklklytgeappdaasaapl, ppdaasaaplwkrmevgqqa, wkrmevgqqaunlabeled, unlabeledtargeted, targetedracing
Peptide Mapping - Agilent BioHPLC Columns Application Compendium
|Agilent Technologies|Guides
Agilent-NISTmAbPeptide MappingAgilent BioHPLC ColumnsApplication Compendium ContentsAgilent-NISTmAb Standard (P/N 5191-5744; 5191-5745) was aliquoted fromNISTmAb RM 8671 batch. Quality control (QC) testing is performed usingAgilent LC-MS system. QC batch release test includes aggregate profile, chargevariants and intact mass information. A certificate of analysis...
Key words
peptide, peptidemapping, mappingpage, pagecontents, contentsback, backadvancebio, advancebiocdr, cdrpeptides, peptidesassaymap, assaymapagilent, agilentmin, minmap, mappqas, pqasattributes, attributesmsd
Enhancing The Quality Of Peptide Mapping Separation For The Analysis Of PTM
2017|Agilent Technologies|Applications
Enhancing The Quality Of PeptideMapping Separation For TheAnalysis Of PTMApplication NoteBiotherapeutics and BiosimilarsAuthorIntroductionSuresh Babu C.V.Post-translational modifications (PTMs) on proteins such as monoclonal antibodies(mAbs) are critical quality attributes (CQAs) that define the drug efficacy andsafety. Characterization of PTMs is a difficult...
Key words
peptide, peptidecounts, countsntaylqmnslr, ntaylqmnslradvancebio, advancebiodltmisr, dltmisrmab, mabeeeqynstr, eeeqynstrptms, ptmsdeamidated, deamidatedplus, plusdigest, digestmapping, mappingseparation, separationnonoxidized, nonoxidizedtryptic
Comprehensive Characterization of the N and O-Linked Glycosylation of a Recombinant Human EPO
2015|Waters|Applications
Comprehensive Characterization of the N and O-Linked Glycosylationof a Recombinant Human EPOMatthew A. Lauber, Stephan M. Koza, and Erin E. ChambersWaters Corporation, Milford, MA, USAA P P L I C AT I O N B E N E F I...
Key words
linked, linkedrhepo, rheporapifluor, rapifluorglycan, glycanepo, epoglycans, glycansglycosylation, glycosylationrecombinant, recombinanthilic, hilichuman, humanglycoworks, glycoworkserythropoietin, erythropoietincharacterization, characterizationcomprehensive, comprehensivedeglycosylated