Quadrupole-Resolved All Ions (Q-RAI) Analysis of Select PFAS Chemicals on an Agilent 6546 LC/Q-TOF
Applications | 2021 | Agilent TechnologiesInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesEnvironmental
ManufacturerAgilent Technologies
Key wordsrai, pfas, acquisition, isolation, ions, lcmrl, quadrupole, precursor, coeluting, compounds, accurate, windows, collision, parameters, outside, mass, energy, spectra, neg, independent, retrospective, fragment, masshunter, width, method, while, from, demonstrates, precursors, untargeted, analysis, widows, data, values, time, pyke, shown, isolations, epa, resolved, kathy, sheath, listed, higher, hunt, predominately, hindle, points, gas, ralph
Similar PDF
Quantification of Per- and Polyfluoroalkyl Substances in Drinking Water
2021|Agilent Technologies|Applications
Application Note Environmental Quantification of Per- and Polyfluoroalkyl Substances in Drinking Water According to EPA Method 533 using an Agilent 6546 LC/Q-TOF Authors Kathy Hunt and Ralph Hindle Vogon Laboratory Services Cochrane, AB, Canada Tarun Anumol Agilent Technologies, Inc. Wilmington,…
Key words
targeted, targetedlcmrl, lcmrlacquisition, acquisitiontof, tofretention, retentionpfas, pfastime, timeprecursor, precursorcompounds, compoundsquadrupole, quadrupolecollision, collisionmass, massmin, minprecursors, precursorsanalysis
Q-RAI Provides Rapid and Sensitive Data Independent Acquisition for Peptide Quantitation
2021|Agilent Technologies|Posters
Poster Reprint ASMS 2021 Poster number MO030 Q-RAI Provides Rapid and Sensitive Data Independent Acquisition for Peptide Quantitation Karen E. Yannell1, Christopher M. Colangelo2, Wendi A. Hale2 1 Agilent, 2 Santa Clara, CA Agilent, Lexington, MA Introduction Experimental Data-independent acquisition…
Key words
rai, raiunmodified, unmodifiedvsnkalpapiek, vsnkalpapiekdiqmtqspstlsasvgdr, diqmtqspstlsasvgdrdata, dataindependent, independentfragment, fragmentdtlmisr, dtlmisroxidation, oxidationacquisition, acquisitionmodified, modifieddia, diamprophet, mprophetwindows, windowshigh
Enhanced Food Safety Testing - A pesticide screening methodology using the Agilent 6546 LC/Q-TOF and MassHunter Quantitative Analysis Software 10.0 LC/Q-TOF Screener Tool
2019|Agilent Technologies|Applications
Application Note Food Testing & Agriculture Enhanced Food Safety Testing A pesticide screening methodology using the Agilent 6546 LC/Q-TOF and MassHunter Quantitative Analysis Software 10.0 LC/Q-TOF Screener Tool Authors Karen E. Yannell and Kai Chen Agilent Technologies, Inc. Santa Clara,…
Key words
screener, screenersuspect, suspectscreening, screeningtof, tofpriority, priorityconventional, conventionalacquisition, acquisitioncompounds, compoundstargets, targetsquantitation, quantitationcounts, countsstrawberry, strawberrydata, databroccoli, broccoliwere
Screening and Identification of Emerging Contaminants in Wastewater Treatment Plant Effluents Using UHPLC/Q-TOF MS and an Accurate Mass Database and Library
2016|Agilent Technologies|Applications
Screening and Identification of Emerging Contaminants in Wastewater Treatment Plant Effluents Using UHPLC/Q-TOF MS and an Accurate Mass Database and Library Application Note Environmental, Emerging contaminants, Water, Accurate mass screening, pesticides, PPCPs Authors Abstract Jean Daniel Berset This application note…
Key words
screening, screeningcounts, countspcdl, pcdlmass, masscontaminants, contaminantsspectrum, spectrumions, ionswwtp, wwtplibrary, librarymasshunter, masshunterwater, watereffluent, effluentcharge, chargeaccurate, accuratewwtps