Q-RAI Provides Rapid and Sensitive Data Independent Acquisition for Peptide Quantitation
Posters | 2021 | Agilent Technologies | ASMSInstrumentation
Data independent acquisition with high resolution mass spectrometry delivers comprehensive fragment information for all ions, ensuring robust analysis of low-abundance peptides and critical quality attributes in protein therapeutics.
This study evaluates the performance of Quadrupole Resolved All Ions (Q-RAI), an untargeted DIA mode, for sensitive and selective quantification of oxidation and deamidation modifications in NISTmAb peptides.
Sample Preparation:
Agilent 6546 LC/Q-TOF system with high resolution, extended dynamic range, and Q-RAI acquisition capabilities.
Q-RAI DIA offers sensitive and selective monitoring of critical quality attributes such as oxidation and deamidation in biopharmaceuticals, with the ability to generate untargeted peptide maps and robust quantitation.
Q-RAI mode on a high-resolution LC/Q-TOF platform provides reliable, high-quality DIA data for quantifying low-level peptide modifications, enhancing analytical workflows for therapeutic protein characterization.
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesProteomics
ManufacturerAgilent Technologies
Summary
Significance of the Topic
Data independent acquisition with high resolution mass spectrometry delivers comprehensive fragment information for all ions, ensuring robust analysis of low-abundance peptides and critical quality attributes in protein therapeutics.
Study Objectives and Overview
This study evaluates the performance of Quadrupole Resolved All Ions (Q-RAI), an untargeted DIA mode, for sensitive and selective quantification of oxidation and deamidation modifications in NISTmAb peptides.
Methodology
Sample Preparation:
- Reduction, alkylation, overnight tryptic digestion at 37 °C.
- Forced oxidation with 0–1% H₂O₂ and forced deamidation at pH 9 for up to 14 days before digestion.
- AdvanceBio Peptide Mapping column (2.1 × 150 mm) with a 25 min gradient.
- Twelve Q-RAI windows spanning m/z 300–1489 (100 amu each, 1 amu overlap), collision energy optimized per window.
- MS1 acquisition at 8 Hz and MS/MS at 14 Hz.
- Spectrum Mill for library creation from DDA runs.
- Skyline with mProphet scoring for DIA processing and quantitative evaluation.
Instrumentation
Agilent 6546 LC/Q-TOF system with high resolution, extended dynamic range, and Q-RAI acquisition capabilities.
Main Results and Discussion
- Mass errors for precursor and fragment ions remained below 5 ppm, demonstrating high mass accuracy and stability.
- mProphet yielded low p and q values, confirming data quality and reliable peak identification.
- Fragment ion intensities scaled proportionally across oxidation levels, enabling precise quantitation of modifications.
- Sequence coverage exceeded 95%, supporting comprehensive peptide mapping.
Benefits and Practical Applications
Q-RAI DIA offers sensitive and selective monitoring of critical quality attributes such as oxidation and deamidation in biopharmaceuticals, with the ability to generate untargeted peptide maps and robust quantitation.
Future Trends and Applications
- Integration with advanced spectral libraries and machine learning for automated PTM analysis.
- Higher throughput via reduced window widths and faster acquisition rates.
- Cloud-based data processing and real-time quality control in biomanufacturing.
- Extension to additional post-translational modifications and complex biological matrices.
Conclusion
Q-RAI mode on a high-resolution LC/Q-TOF platform provides reliable, high-quality DIA data for quantifying low-level peptide modifications, enhancing analytical workflows for therapeutic protein characterization.
References
- Pino LK et al. Mass Spectrom Rev. 2020;39(3):229–244.
- Doerr A. Nat Methods. 2015;12:35.
- Reiter L et al. Nat Methods. 2011;8:430–435.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Characterization of control and stress induced samples of trastuzumab biosimilar using LCMS-9030 by bottom-up approach
2021|Shimadzu|Applications
Liquid Chromatograph Mass Spectrometer LCMS™-9030 Application News Characterization of control and stress induced samples of trastuzumab biosimilar using LCMS-9030 by bottom-up approach Amita Puranik 1 , Deepti Bhandarkar 2, Prajakta Dandekar 3 , Pratap Rasam 2 , Tian hua Wang…
Key words
peptide, peptideunmodified, unmodifiedinduced, inducedstress, stressdeamidation, deamidationoxidation, oxidationptms, ptmsmodifications, modificationssusceptible, susceptiblemodified, modifiedcontrol, controlmodification, modificationmapping, mappingmab, mabnews
A Fast and Simple Workflow for Monoclonal Antibody (mAb) Post-Translational Modifications (PTM) Study Using Shimadzu LCMS-9030 Q-TOF
2023|Shimadzu|Applications
Peptide Mapping Analysis of Monoclonal Antibody / LCMS-9030 Application News A Fast and Simple Workflow for Monoclonal Antibody (mAb) Post-Translational Modifications (PTM) Study Using Shimadzu LCMS-9030 Q-TOF Shannie Tay1, Max Kosok1, Yu Jie Lee2 Shimadzu Asia Pacific, Singapore 2 National…
Key words
gfypsdiavewesngqpennyk, gfypsdiavewesngqpennykgfypsdiavewesngqpennykttppvldsdgsfflysk, gfypsdiavewesngqpennykttppvldsdgsfflyskmetrics, metricspeptide, peptideprotein, proteinmabs, mabsptm, ptmmodifications, modificationsstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqty, stsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyamino, aminoicnvnhkpsntk, icnvnhkpsntkxics, xicsmodified, modifiedvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk, vqwkvdnalqsgnsqesvteqdskdstyslsstltlskepqvytlppsreemtknqvsltclvk
Quadrupole-Resolved All Ions (Q-RAI) Analysis of Select PFAS Chemicals on an Agilent 6546 LC/Q-TOF
2021|Agilent Technologies|Applications
Application Note Environmental Quadrupole-Resolved All Ions (Q-RAI) Analysis of Select PFAS Chemicals on an Agilent 6546 LC/Q-TOF Authors Kathy Hunt and Ralph Hindle Vogon Laboratory Services Ltd. Cochrane, AB, Canada Tarun Anumol, Chris Klein, and James Pyke Agilent Technologies, Inc.…
Key words
rai, raiacquisition, acquisitionisolation, isolationpfas, pfasions, ionslcmrl, lcmrlquadrupole, quadrupoleprecursor, precursorcoeluting, coelutingcompounds, compoundsaccurate, accuratecollision, collisionwindows, windowsmass, massoutside
Peptide Mapping of Innovator and Biosimilar Monoclonal Antibody Using an Agilent 1290 Infinity UHPLC Coupled to an Agilent 6550 iFunnel Q-TOF LC/MS System
2017|Agilent Technologies|Applications
Peptide Mapping of Innovator and Biosimilar Monoclonal Antibody Using an Agilent 1290 Infinity UHPLC Coupled to an Agilent 6550 iFunnel Q-TOF LC/MS System Application Note Author Introduction Ravindra Gudihal Monoclonal antibodies (mAbs) are becoming one of the important classes of…
Key words
peptide, peptideinnovator, innovatorbiosimilar, biosimilardeamidation, deamidationcounts, countsdltmisr, dltmisroxidation, oxidationmapping, mappingtrypsin, trypsinunmodified, unmodifiedoxi, oxiions, ionsheight, heightgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykcharge