LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Q-RAI Provides Rapid and Sensitive Data Independent Acquisition for Peptide Quantitation

 

Similar PDF

Toggle
Liquid Chromatograph Mass Spectrometer LCMS™-9030 Application News Characterization of control and stress induced samples of trastuzumab biosimilar using LCMS-9030 by bottom-up approach Amita Puranik 1 , Deepti Bhandarkar 2, Prajakta Dandekar 3 , Pratap Rasam 2 , Tian hua Wang…
Key words
peptide, peptideunmodified, unmodifiedstress, stressinduced, induceddeamidation, deamidationoxidation, oxidationptms, ptmsmodifications, modificationsmodified, modifiedsusceptible, susceptiblecontrol, controlmodification, modificationmapping, mappingmab, mabnews
Peptide Mapping Analysis of Monoclonal Antibody / LCMS-9030 Application News A Fast and Simple Workflow for Monoclonal Antibody (mAb) Post-Translational Modifications (PTM) Study Using Shimadzu LCMS-9030 Q-TOF Shannie Tay1, Max Kosok1, Yu Jie Lee2 Shimadzu Asia Pacific, Singapore 2 National…
Key words
gfypsdiavewesngqpennykttppvldsdgsfflysk, gfypsdiavewesngqpennykttppvldsdgsfflyskgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykmetrics, metricspeptide, peptideprotein, proteinmabs, mabsptm, ptmmodifications, modificationsicnvnhkpsntk, icnvnhkpsntkstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqty, stsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyamino, aminomodified, modifiedxics, xicsvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk, vqwkvdnalqsgnsqesvteqdskdstyslsstltlskepqvytlppsreemtknqvsltclvk
Application Note Biotherapeutics Quantitation of Chemical-Induced Deamidation and Oxidation on Monoclonal Antibodies Using Agilent 6545XT AdvanceBio LC/Q-TOF and Agilent MassHunter BioConfirm Software Author Linfeng Wu Agilent Technologies, Inc. Santa Clara, CA, USA Introduction Modifications such as asparagine (Asn) deamidation, aspartate…
Key words
deamidation, deamidationpeptide, peptideasn, asndeamidated, deamidatedoxidation, oxidationunmodified, unmodifiedasp, asppeptides, peptidesquantitation, quantitationisomerization, isomerizationforms, formspenny, pennybioconfirm, bioconfirmptm, ptmmasshunter
Peptide Mapping of Innovator and Biosimilar Monoclonal Antibody Using an Agilent 1290 Infinity UHPLC Coupled to an Agilent 6550 iFunnel Q-TOF LC/MS System Application Note Author Introduction Ravindra Gudihal Monoclonal antibodies (mAbs) are becoming one of the important classes of…
Key words
peptide, peptideinnovator, innovatorbiosimilar, biosimilardeamidation, deamidationcounts, countsoxidation, oxidationdltmisr, dltmisrmapping, mappingtrypsin, trypsinunmodified, unmodifiedoxi, oxiions, ionsheight, heightcharge, chargedem
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike