A Fast and Simple Workflow for Monoclonal Antibody (mAb) Post-Translational Modifications (PTM) Study Using Shimadzu LCMS-9030 Q-TOF

Applications | 2023 | ShimadzuInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Industries
Pharma & Biopharma
Manufacturer
Shimadzu

Summary

Importance of the Topic


Monoclonal antibodies (mAbs) represent a cornerstone in biopharmaceutical development, with their structural integrity and functional efficacy heavily influenced by post-translational modifications (PTMs). Accurate mapping of PTMs such as oxidation, deamidation, glycosylation, and C-terminal clipping is essential to ensure product quality, stability, and therapeutic performance throughout the drug development pipeline.

Objectives and Study Overview


This work presents a rapid and straightforward workflow for quantifying site-specific PTMs in a reference mAb (NISTmAb RM 8671). The goals are to achieve comprehensive sequence coverage, identify common modification hotspots, and provide reliable relative abundance data using high-resolution Q-TOF mass spectrometry coupled with specialized data processing software.

Methodology and Instrumentation


The mAb sample preparation involved reduction with DTT, alkylation with iodoacetamide, phosphoric acid quenching, and cleanup on S-Trap mini spin columns. Trypsin digestion (1:20 w/w) at 47 °C for one hour yielded peptide fragments, which were eluted, concentrated, and reconstituted in 0.1% formic acid prior to analysis.

Liquid chromatography was performed on a Shim-pack Arata Peptide C18 column (2.0×150 mm, 2.2 µm) using a 65-minute gradient of 0.1% formic acid in water (phase A) and acetonitrile (phase B) at 0.2 mL/min and 65 °C. Mass spectrometric detection employed the Shimadzu LCMS-9030 Q-TOF in data-dependent acquisition (DDA) mode, scanning m/z 200–2000 for MS and 50–2000 for MS/MS, with a collision energy spread to optimize fragmentation.

Data were processed using Protein Metrics PTM workflow. Parameters included a 15 ppm precursor tolerance, allowance of up to two missed cleavages, fixed carbamidomethylation on cysteines, and variable common modifications such as methionine oxidation, asparagine/glutamine deamidation, pyro-glutamate formation, and C-terminal lysine loss. Glycan identification used a custom N-glycan library.

Main Results and Discussion


The method provided 100% sequence coverage of both heavy and light chains, successfully identifying all complementarity-determining regions (CDRs). Peptides exhibited baseline separation in the 2–40 minute window. Key findings include:
  • C-terminal lysine clipping at heavy chain position 450 exceeded 75% relative abundance.
  • N-glycosylation at the consensus site showed several glycoforms, with the most abundant biantennary structures representing over 30% each.
  • Methionine oxidation and asparagine deamidation hotspots were detected at low to moderate levels (below 30%).

Representative spectra highlighted distinct mass differences for modified versus unmodified peptides, and software annotations confirmed neutral losses (e.g., water loss events) and iminium ion patterns.

Benefits and Practical Applications


  • The streamlined workflow enables rapid PTM quantification, essential for lot-to-lot comparison and stability studies.
  • High-resolution Q-TOF data enhances confidence in distinguishing closely spaced mass shifts.
  • Protein Metrics software automates relative abundance calculations, facilitating routine monitoring in early-stage and late-stage development.

Future Trends and Opportunities


Advances in high-throughput sample preparation and enhanced data-independent acquisition (DIA) strategies are expected to further improve coverage and quantitation accuracy. Integration of machine learning algorithms for automated PTM pattern recognition and predictive stability modeling will accelerate decision-making in biopharmaceutical workflows.

Conclusion


This study demonstrates a robust, easy-to-implement peptide mapping protocol for mAb PTM analysis. The combination of Shimadzu LCMS-9030 Q-TOF and Protein Metrics software achieves complete sequence coverage, precise PTM site localization, and reliable relative abundance measurements—critical parameters for quality control and characterization of therapeutic antibodies.

Reference


  1. Mouchahoir T., Schiel J.E. Development of an LC-MS/MS peptide mapping protocol for the NISTmAb. Analytical and Bioanalytical Chemistry. 2018;410:2111–2126.
  2. Beyer B., Schuster M., Jungbauer A., Lingg N. Microheterogeneity of Recombinant Antibodies: Analytics and Functional Impact. Biotechnology Journal. 2017;12(5):1700476.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Characterization of Monoclonal Antibody (mAb) using Shimadzu Q-TOF LCMS 9030
ThP 407 Characterization of Monoclonal Antibody (mAb) using Shimadzu Q-TOF LCMS 9030 Shannie Tay 1, Max Kosok1, Yu Jie Lee2 (1) Shimadzu (Asia Pacific), Singapore (2) National University of Singapore, Singapore. 1. Introduction 3. Results Sample name ◆ Monoclonal antibody…
Key words
gfypsdiavewesngqpennyk, gfypsdiavewesngqpennykgfypsdiavewesngqpennykttppvldsdgsfflysk, gfypsdiavewesngqpennykttppvldsdgsfflysksubunit, subunitintact, intactstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss, stsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntk, vvtvpssslgtqtyicnvnhkpsntkname, namevqwkvdnalqsgnsqesvteqdskdstyslsstltlsk, vqwkvdnalqsgnsqesvteqdskdstyslsstltlskepqvytlppsreemtknqvsltclvk, epqvytlppsreemtknqvsltclvkvvsvltvlhqdwlngkeykck, vvsvltvlhqdwlngkeykcknist, nistnqvsltclvk, nqvsltclvkmass, massvvsvltvlhqdwlngk, vvsvltvlhqdwlngkprotein
Characterization of control and stress induced samples of trastuzumab biosimilar using LCMS-9030 by bottom-up approach
Liquid Chromatograph Mass Spectrometer LCMS™-9030 Application News Characterization of control and stress induced samples of trastuzumab biosimilar using LCMS-9030 by bottom-up approach Amita Puranik 1 , Deepti Bhandarkar 2, Prajakta Dandekar 3 , Pratap Rasam 2 , Tian hua Wang…
Key words
peptide, peptideunmodified, unmodifiedstress, stressinduced, induceddeamidation, deamidationoxidation, oxidationptms, ptmsmodifications, modificationssusceptible, susceptiblemodified, modifiedcontrol, controlmodification, modificationmapping, mappingmab, mabnews
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestprime, primeduo, duomagnetic, magneticadalimumab
Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis
APPLICATION NOTE 21781 Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis Authors Silvia Millán, Craig Jakes, Noemí Dorival, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing Research and…
Key words
eeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrpeptide, peptidesmart, smartdigestion, digestionmodifications, modificationssequence, sequencerelative, relativemapping, mappingdigest, digestterminal, terminalscientific, scientificptms, ptmsoptima, optimaabundance
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike