A Fast and Simple Workflow for Monoclonal Antibody (mAb) Post-Translational Modifications (PTM) Study Using Shimadzu LCMS-9030 Q-TOF
Applications | 2023 | ShimadzuInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesPharma & Biopharma
ManufacturerShimadzu
Key wordsgfypsdiavewesngqpennykttppvldsdgsfflysk, gfypsdiavewesngqpennyk, metrics, peptide, protein, mabs, ptm, modifications, icnvnhkpsntk, stsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqty, amino, modified, xics, vqwkvdnalqsgnsqesvteqdskdstyslsstltlsk, epqvytlppsreemtknqvsltclvk, vvsvltvlhqdwlngkeykck, abundance, relative, dda, peptides, nqvsltclvk, news, vvsvltvlhqdwlngk, modification, monoclonal, antibody, antigen, acid, workflow, chain, site, term, ltvdksrwqqgnvfscsvmhealhnhytqk, qvtlresgpalvkptqtltltctfsgfslstagmsvgwir, unformatted, lysine, using, nxs, sfnrgec, iminium, qvtlr, tvaapsvfifppsdeqlksgtasvvcllnnfypr, yin, event, oxidation, soh, trended, mapping, ang, vvsvltvlhqdwlngkeyk
Similar PDF
Characterization of control and stress induced samples of trastuzumab biosimilar using LCMS-9030 by bottom-up approach
2021|Shimadzu|Applications
Liquid Chromatograph Mass Spectrometer LCMS™-9030 Application News Characterization of control and stress induced samples of trastuzumab biosimilar using LCMS-9030 by bottom-up approach Amita Puranik 1 , Deepti Bhandarkar 2, Prajakta Dandekar 3 , Pratap Rasam 2 , Tian hua Wang…
Key words
peptide, peptideunmodified, unmodifiedstress, stressinduced, induceddeamidation, deamidationoxidation, oxidationptms, ptmsmodifications, modificationsmodified, modifiedsusceptible, susceptiblecontrol, controlmodification, modificationmapping, mappingmab, mabnews
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestduo, duomagnetic, magneticprime, primeadalimumab
Monoclonal Antibody Workflows on the Shimadzu Q-TOF LCMS-9030 Using the Protein Metrics Software Suite
2019|Shimadzu|Applications
No. SSI-LCMS-103 SSI-LCMS-103 Liquid Chromatography Mass Spectrometry Monoclonal Antibody Workflows on the Shimadzu Q-TOF LCMSTM-9030 Using the Protein Metrics Software Suite No. LCMS-103 Stephen Kurzyniec, Vikki Johnson Shimadzu Scientific Instruments, Inc. ■ Abstract Accurate characterization of monoclonal antibodies is essential…
Key words
intact, intactprotein, proteinmetrics, metricstof, tofmab, mabsubunit, subunitdda, ddaflow, flowtemp, tempdeconvoluted, deconvolutedmonoclonal, monoclonaldigestion, digestionsubunits, subunitsenzymes, enzymesgas
Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21781 Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis Authors Silvia Millán, Craig Jakes, Noemí Dorival, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing Research and…
Key words
eeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrpeptide, peptidesmart, smartdigestion, digestionsequence, sequencemodifications, modificationsrelative, relativemapping, mappingscientific, scientificterminal, terminaldigest, digestptms, ptmsoptima, optimaabundance