A Fast and Simple Workflow for Monoclonal Antibody (mAb) Post-Translational Modifications (PTM) Study Using Shimadzu LCMS-9030 Q-TOF
Applications | 2023 | ShimadzuInstrumentation
Monoclonal antibodies (mAbs) represent a cornerstone in biopharmaceutical development, with their structural integrity and functional efficacy heavily influenced by post-translational modifications (PTMs). Accurate mapping of PTMs such as oxidation, deamidation, glycosylation, and C-terminal clipping is essential to ensure product quality, stability, and therapeutic performance throughout the drug development pipeline.
This work presents a rapid and straightforward workflow for quantifying site-specific PTMs in a reference mAb (NISTmAb RM 8671). The goals are to achieve comprehensive sequence coverage, identify common modification hotspots, and provide reliable relative abundance data using high-resolution Q-TOF mass spectrometry coupled with specialized data processing software.
The mAb sample preparation involved reduction with DTT, alkylation with iodoacetamide, phosphoric acid quenching, and cleanup on S-Trap mini spin columns. Trypsin digestion (1:20 w/w) at 47 °C for one hour yielded peptide fragments, which were eluted, concentrated, and reconstituted in 0.1% formic acid prior to analysis.
Liquid chromatography was performed on a Shim-pack Arata Peptide C18 column (2.0×150 mm, 2.2 µm) using a 65-minute gradient of 0.1% formic acid in water (phase A) and acetonitrile (phase B) at 0.2 mL/min and 65 °C. Mass spectrometric detection employed the Shimadzu LCMS-9030 Q-TOF in data-dependent acquisition (DDA) mode, scanning m/z 200–2000 for MS and 50–2000 for MS/MS, with a collision energy spread to optimize fragmentation.
Data were processed using Protein Metrics PTM workflow. Parameters included a 15 ppm precursor tolerance, allowance of up to two missed cleavages, fixed carbamidomethylation on cysteines, and variable common modifications such as methionine oxidation, asparagine/glutamine deamidation, pyro-glutamate formation, and C-terminal lysine loss. Glycan identification used a custom N-glycan library.
The method provided 100% sequence coverage of both heavy and light chains, successfully identifying all complementarity-determining regions (CDRs). Peptides exhibited baseline separation in the 2–40 minute window. Key findings include:
Representative spectra highlighted distinct mass differences for modified versus unmodified peptides, and software annotations confirmed neutral losses (e.g., water loss events) and iminium ion patterns.
Advances in high-throughput sample preparation and enhanced data-independent acquisition (DIA) strategies are expected to further improve coverage and quantitation accuracy. Integration of machine learning algorithms for automated PTM pattern recognition and predictive stability modeling will accelerate decision-making in biopharmaceutical workflows.
This study demonstrates a robust, easy-to-implement peptide mapping protocol for mAb PTM analysis. The combination of Shimadzu LCMS-9030 Q-TOF and Protein Metrics software achieves complete sequence coverage, precise PTM site localization, and reliable relative abundance measurements—critical parameters for quality control and characterization of therapeutic antibodies.
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesPharma & Biopharma
ManufacturerShimadzu
Summary
Importance of the Topic
Monoclonal antibodies (mAbs) represent a cornerstone in biopharmaceutical development, with their structural integrity and functional efficacy heavily influenced by post-translational modifications (PTMs). Accurate mapping of PTMs such as oxidation, deamidation, glycosylation, and C-terminal clipping is essential to ensure product quality, stability, and therapeutic performance throughout the drug development pipeline.
Objectives and Study Overview
This work presents a rapid and straightforward workflow for quantifying site-specific PTMs in a reference mAb (NISTmAb RM 8671). The goals are to achieve comprehensive sequence coverage, identify common modification hotspots, and provide reliable relative abundance data using high-resolution Q-TOF mass spectrometry coupled with specialized data processing software.
Methodology and Instrumentation
The mAb sample preparation involved reduction with DTT, alkylation with iodoacetamide, phosphoric acid quenching, and cleanup on S-Trap mini spin columns. Trypsin digestion (1:20 w/w) at 47 °C for one hour yielded peptide fragments, which were eluted, concentrated, and reconstituted in 0.1% formic acid prior to analysis.
Liquid chromatography was performed on a Shim-pack Arata Peptide C18 column (2.0×150 mm, 2.2 µm) using a 65-minute gradient of 0.1% formic acid in water (phase A) and acetonitrile (phase B) at 0.2 mL/min and 65 °C. Mass spectrometric detection employed the Shimadzu LCMS-9030 Q-TOF in data-dependent acquisition (DDA) mode, scanning m/z 200–2000 for MS and 50–2000 for MS/MS, with a collision energy spread to optimize fragmentation.
Data were processed using Protein Metrics PTM workflow. Parameters included a 15 ppm precursor tolerance, allowance of up to two missed cleavages, fixed carbamidomethylation on cysteines, and variable common modifications such as methionine oxidation, asparagine/glutamine deamidation, pyro-glutamate formation, and C-terminal lysine loss. Glycan identification used a custom N-glycan library.
Main Results and Discussion
The method provided 100% sequence coverage of both heavy and light chains, successfully identifying all complementarity-determining regions (CDRs). Peptides exhibited baseline separation in the 2–40 minute window. Key findings include:
- C-terminal lysine clipping at heavy chain position 450 exceeded 75% relative abundance.
- N-glycosylation at the consensus site showed several glycoforms, with the most abundant biantennary structures representing over 30% each.
- Methionine oxidation and asparagine deamidation hotspots were detected at low to moderate levels (below 30%).
Representative spectra highlighted distinct mass differences for modified versus unmodified peptides, and software annotations confirmed neutral losses (e.g., water loss events) and iminium ion patterns.
Benefits and Practical Applications
- The streamlined workflow enables rapid PTM quantification, essential for lot-to-lot comparison and stability studies.
- High-resolution Q-TOF data enhances confidence in distinguishing closely spaced mass shifts.
- Protein Metrics software automates relative abundance calculations, facilitating routine monitoring in early-stage and late-stage development.
Future Trends and Opportunities
Advances in high-throughput sample preparation and enhanced data-independent acquisition (DIA) strategies are expected to further improve coverage and quantitation accuracy. Integration of machine learning algorithms for automated PTM pattern recognition and predictive stability modeling will accelerate decision-making in biopharmaceutical workflows.
Conclusion
This study demonstrates a robust, easy-to-implement peptide mapping protocol for mAb PTM analysis. The combination of Shimadzu LCMS-9030 Q-TOF and Protein Metrics software achieves complete sequence coverage, precise PTM site localization, and reliable relative abundance measurements—critical parameters for quality control and characterization of therapeutic antibodies.
Reference
- Mouchahoir T., Schiel J.E. Development of an LC-MS/MS peptide mapping protocol for the NISTmAb. Analytical and Bioanalytical Chemistry. 2018;410:2111–2126.
- Beyer B., Schuster M., Jungbauer A., Lingg N. Microheterogeneity of Recombinant Antibodies: Analytics and Functional Impact. Biotechnology Journal. 2017;12(5):1700476.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Characterization of Monoclonal Antibody (mAb) using Shimadzu Q-TOF LCMS 9030
2024|Shimadzu|Posters
ThP 407 Characterization of Monoclonal Antibody (mAb) using Shimadzu Q-TOF LCMS 9030 Shannie Tay 1, Max Kosok1, Yu Jie Lee2 (1) Shimadzu (Asia Pacific), Singapore (2) National University of Singapore, Singapore. 1. Introduction 3. Results Sample name ◆ Monoclonal antibody…
Key words
gfypsdiavewesngqpennykttppvldsdgsfflysk, gfypsdiavewesngqpennykttppvldsdgsfflyskgfypsdiavewesngqpennyk, gfypsdiavewesngqpennyksubunit, subunitintact, intactstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss, stsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntk, vvtvpssslgtqtyicnvnhkpsntkvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk, vqwkvdnalqsgnsqesvteqdskdstyslsstltlskname, nameepqvytlppsreemtknqvsltclvk, epqvytlppsreemtknqvsltclvkvvsvltvlhqdwlngkeykck, vvsvltvlhqdwlngkeykcknist, nistnqvsltclvk, nqvsltclvkmass, massvvsvltvlhqdwlngk, vvsvltvlhqdwlngkprotein
Characterization of control and stress induced samples of trastuzumab biosimilar using LCMS-9030 by bottom-up approach
2021|Shimadzu|Applications
Liquid Chromatograph Mass Spectrometer LCMS™-9030 Application News Characterization of control and stress induced samples of trastuzumab biosimilar using LCMS-9030 by bottom-up approach Amita Puranik 1 , Deepti Bhandarkar 2, Prajakta Dandekar 3 , Pratap Rasam 2 , Tian hua Wang…
Key words
peptide, peptideunmodified, unmodifiedstress, stressinduced, induceddeamidation, deamidationoxidation, oxidationptms, ptmsmodifications, modificationssusceptible, susceptiblemodified, modifiedcontrol, controlmodification, modificationmapping, mappingmab, mabufaccumulation
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestprime, primeduo, duomagnetic, magneticsrwqqgnvfscsvmhealhnhytqk
Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21781 Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis Authors Silvia Millán, Craig Jakes, Noemí Dorival, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing Research and…
Key words
eeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrpeptide, peptidesmart, smartdigestion, digestionmodifications, modificationssequence, sequencerelative, relativemapping, mappingdigest, digestscientific, scientificterminal, terminalptms, ptmsoptima, optimaabundance