Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis
Applications | 2018 | Thermo Fisher ScientificInstrumentation
Peptide mapping is a fundamental analytical workflow for characterizing monoclonal antibodies (mAbs) and biotherapeutics. It provides detailed information on primary amino acid sequence, post-translational modifications (PTMs), and structural integrity, which are critical for ensuring drug safety, efficacy, and regulatory compliance. High-throughput, reproducible methods reduce assay variability and enable efficient batch-to-batch comparability in biopharmaceutical development.
This investigation evaluated the performance of the Thermo Scientific™ SMART Digest™ kit for rapid enzymatic digestion of the NISTmAb RM 8671 reference material. A time-course study (15–75 minutes) assessed digestion efficiency, sequence coverage, and identification and relative quantification of key PTMs such as deamidation, oxidation, glycation, and glycosylation. The overall goal was to demonstrate a streamlined workflow suitable for high-throughput peptide mapping with minimal sample preparation–induced artifacts.
The study employed a bottom-up peptide mapping approach combining the SMART Digest heat-stable immobilized trypsin workflow with high-resolution LC-MS analysis. Sample preparation involved dilution of the NISTmAb to 2 mg/mL, enzymatic digestion at 70 °C with agitation for 15, 30, 45, 60, or 75 minutes, resin removal, disulfide reduction with DTT, and acidification prior to UHPLC-MS injection.
Instrumentation used:
• Sequence coverage for both heavy and light chains reached 100 % across all digestion times (15–75 min) with high confidence (≥ 95 %) and mass accuracy (≤ 5 ppm).
• Chromatographic reproducibility was excellent, with retention time precision (RSD) ≤ 0.2 % for monitored peptides.
• Complete digestion was achieved in as little as 30 minutes, yielding over 1 300 identified components and robust MS signal intensity.
• Sample preparation–induced PTMs remained low: N-terminal pyroglutamate formation exceeded 99 %, glycosylation profiles (A2G0F, A2G1F, A2G2F, Man5) matched expected NISTmAb patterns, oxidation levels of methionine and tryptophan remained < 3 %, and glycation on lysine residues was < 1.7 %.
• Deamidation exhibited a predictable increase with extended digestion time, rising from ~ 6.95 % (N318) at 15 min to ~ 10.62 % at 75 min, reflecting temperature- and pH-dependent kinetics.
• Rapid, automated digestion reduces total assay time and labor compared to traditional in-solution protocols.
• High sequence coverage and low artifact levels enhance confidence in PTM profiling for QA/QC and comparability studies.
• The workflow supports high-throughput screening of mAb candidates and manufacturing batches with minimal manual intervention.
Advancements may include integration of multi-enzyme digestion strategies, further automation of sample preparation, real-time online monitoring of enzymatic reactions, and application of AI-driven data analysis to accelerate identification of low-abundance PTMs. Emerging high-resolution instruments and improved software algorithms will enable deeper structural characterization and faster turnaround times for biopharmaceutical development.
The SMART Digest kit combined with Vanquish UHPLC-Orbitrap MS provides a robust, high-throughput peptide mapping platform for mAb characterization. Rapid digestion, complete sequence coverage, excellent reproducibility, and minimal preparation-induced modifications make this workflow an attractive option for biopharmaceutical research, development, and quality control.
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
IndustriesProteomics
ManufacturerThermo Fisher Scientific
Summary
Significance of the topic
Peptide mapping is a fundamental analytical workflow for characterizing monoclonal antibodies (mAbs) and biotherapeutics. It provides detailed information on primary amino acid sequence, post-translational modifications (PTMs), and structural integrity, which are critical for ensuring drug safety, efficacy, and regulatory compliance. High-throughput, reproducible methods reduce assay variability and enable efficient batch-to-batch comparability in biopharmaceutical development.
Study objectives and overview
This investigation evaluated the performance of the Thermo Scientific™ SMART Digest™ kit for rapid enzymatic digestion of the NISTmAb RM 8671 reference material. A time-course study (15–75 minutes) assessed digestion efficiency, sequence coverage, and identification and relative quantification of key PTMs such as deamidation, oxidation, glycation, and glycosylation. The overall goal was to demonstrate a streamlined workflow suitable for high-throughput peptide mapping with minimal sample preparation–induced artifacts.
Methodology and instrumentation
The study employed a bottom-up peptide mapping approach combining the SMART Digest heat-stable immobilized trypsin workflow with high-resolution LC-MS analysis. Sample preparation involved dilution of the NISTmAb to 2 mg/mL, enzymatic digestion at 70 °C with agitation for 15, 30, 45, 60, or 75 minutes, resin removal, disulfide reduction with DTT, and acidification prior to UHPLC-MS injection.
Instrumentation used:
- Vanquish™ Flex Binary UHPLC system with Acclaim VANQUISH C18 column (2.1 × 250 mm, 2.2 µm)
- Q Exactive™ Plus Hybrid Quadrupole-Orbitrap™ mass spectrometer
- BioPharma Finder™ and Xcalibur™ software for data acquisition and peptide identification
Main results and discussion
• Sequence coverage for both heavy and light chains reached 100 % across all digestion times (15–75 min) with high confidence (≥ 95 %) and mass accuracy (≤ 5 ppm).
• Chromatographic reproducibility was excellent, with retention time precision (RSD) ≤ 0.2 % for monitored peptides.
• Complete digestion was achieved in as little as 30 minutes, yielding over 1 300 identified components and robust MS signal intensity.
• Sample preparation–induced PTMs remained low: N-terminal pyroglutamate formation exceeded 99 %, glycosylation profiles (A2G0F, A2G1F, A2G2F, Man5) matched expected NISTmAb patterns, oxidation levels of methionine and tryptophan remained < 3 %, and glycation on lysine residues was < 1.7 %.
• Deamidation exhibited a predictable increase with extended digestion time, rising from ~ 6.95 % (N318) at 15 min to ~ 10.62 % at 75 min, reflecting temperature- and pH-dependent kinetics.
Benefits and practical applications
• Rapid, automated digestion reduces total assay time and labor compared to traditional in-solution protocols.
• High sequence coverage and low artifact levels enhance confidence in PTM profiling for QA/QC and comparability studies.
• The workflow supports high-throughput screening of mAb candidates and manufacturing batches with minimal manual intervention.
Future trends and opportunities
Advancements may include integration of multi-enzyme digestion strategies, further automation of sample preparation, real-time online monitoring of enzymatic reactions, and application of AI-driven data analysis to accelerate identification of low-abundance PTMs. Emerging high-resolution instruments and improved software algorithms will enable deeper structural characterization and faster turnaround times for biopharmaceutical development.
Conclusion
The SMART Digest kit combined with Vanquish UHPLC-Orbitrap MS provides a robust, high-throughput peptide mapping platform for mAb characterization. Rapid digestion, complete sequence coverage, excellent reproducibility, and minimal preparation-induced modifications make this workflow an attractive option for biopharmaceutical research, development, and quality control.
References
- Reichert JM. Antibodies to watch in 2017. MAbs. 2017;9(2):167–181.
- Gucinski AC, Boyne MT. Evaluation of intact mass spectrometry for the quantitative analysis of protein therapeutics. Anal Chem. 2012;84(18):8045–8051.
- Jefferis R. Posttranslational modifications and immunogenicity of biotherapeutics. J Immunol Res. 2016;2016:1–15.
- Beck A, Wagner-Rousset E, Ayoub D, et al. Characterization of therapeutic antibodies. Anal Chem. 2013;85(2):715–736.
- EMA ICH Q6B: Specifications: Test Procedures and Acceptance Criteria for Biotechnological/Biological Products. 1999.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestprime, primeduo, duomagnetic, magneticadalimumab
SMART Digest Peptide Mapping and Quantitation Compendium
2018|Thermo Fisher Scientific|Guides
Table of Contents Introduction Faster and More Sensitive Protein Characterization and Quantitation Easier Digestion Faster Digestion Highly Reproducible Digestion Automation of Digestion Improving Sensitivity and Speed SMART Digest Peptide Mapping and Quantitation Compendium Peptide Mapping Peptide Quantitation Product and Method…
Key words
mapping, mappingpeptide, peptidedigestion, digestionsmart, smartmodifications, modificationsdigest, digestchain, chainposttranslational, posttranslationalheavy, heavymonoclonal, monoclonaltrypsin, trypsinantibodies, antibodiesthroughput, throughputprotein, proteinautomated
Comparison of alternative approaches to trypsin protein digestion for reproducible and efficient peptide mapping analysis of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21782 Comparison of alternative approaches to trypsin protein digestion for reproducible and efficient peptide mapping analysis of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Noemi Dorival-García, Nicola McGillicuddy, Sara Carillo, Amy Farrell, Jonathan Bones National Institute for Bioprocessing…
Key words
smart, smartdigest, digestadalimumab, adalimumabdigestion, digestionmagnetic, magneticmodifications, modificationsalternative, alternativepeptide, peptiderapid, rapiddeamidation, deamidationmapping, mappingrelative, relativenistmab, nistmabinduced, inducedsample
SMART Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization
2016|Thermo Fisher Scientific|Applications
APPLICATION NOTE Authors: Martin Samonig1, Alexander Schwahn2, Ken Cook3, Mike Oliver4, and Remco Swart1 Thermo Fisher Scientific, Germering, Germany; 2Thermo Fisher Scientific, Basel, Switzerland; 3Thermo Fisher Scientific, Hemel Hempstead, United Kingdom; 4 Thermo Fisher Scientific, Runcorn, United Kingdom 1 Key…
Key words
smart, smartdigest, digestdigestion, digestiondeamidation, deamidationurea, ureamodifications, modificationscarbamylation, carbamylationrituximab, rituximabpeptide, peptidemodification, modificationrelative, relativeabundance, abundanceheat, heatscientific, scientificheavy