SMART Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization
Applications | 2016 | Thermo Fisher ScientificInstrumentation
Sample Preparation, LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
IndustriesProteomics
ManufacturerThermo Fisher Scientific
Key wordssmart, digest, digestion, deamidation, urea, modifications, carbamylation, peptide, rituximab, modification, relative, abundance, heat, scientific, thermo, solution, heavy, chain, kit, oxidation, setting, were, digested, protein, mwc, induced, mapping, light, monoclonal, classic, sample, time, rsd, glutamine, terminal, sequence, chemical, pyro, minutes, identified, mab, lcms, coverage, protease, observed, detected, max, achieved, gln, denaturation
Similar PDF
SMART Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization
2016|Thermo Fisher Scientific|Applications
APPLICATION NOTE Authors: Martin Samonig1, Alexander Schwahn2, Ken Cook3, Mike Oliver4, and Remco Swart1 Thermo Fisher Scientific, Germering, Germany; 2Thermo Fisher Scientific, Basel, Switzerland; 3Thermo Fisher Scientific, Hemel Hempstead, United Kingdom; 4 Thermo Fisher Scientific, Runcorn, United Kingdom 1 Key…
Key words
smart, smartdigest, digestdigestion, digestiondeamidation, deamidationurea, ureamodifications, modificationspeptide, peptiderituximab, rituximabcarbamylation, carbamylationmodification, modificationrelative, relativeabundance, abundanceheat, heatscientific, scientificthermo
SMART Digest Peptide Mapping and Quantitation Compendium
2018|Thermo Fisher Scientific|Guides
Table of Contents Introduction Faster and More Sensitive Protein Characterization and Quantitation Easier Digestion Faster Digestion Highly Reproducible Digestion Automation of Digestion Improving Sensitivity and Speed SMART Digest Peptide Mapping and Quantitation Compendium Peptide Mapping Peptide Quantitation Product and Method…
Key words
mapping, mappingpeptide, peptidedigestion, digestionsmart, smartmodifications, modificationsdigest, digestchain, chainposttranslational, posttranslationalheavy, heavymonoclonal, monoclonaltrypsin, trypsinantibodies, antibodiesprotein, proteinthroughput, throughputautomated
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestduo, duoprime, primemagnetic, magneticsrwqqgnvfscsvmhealhnhytqk
Comparison of alternative approaches to trypsin protein digestion for reproducible and efficient peptide mapping analysis of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21782 Comparison of alternative approaches to trypsin protein digestion for reproducible and efficient peptide mapping analysis of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Noemi Dorival-García, Nicola McGillicuddy, Sara Carillo, Amy Farrell, Jonathan Bones National Institute for Bioprocessing…
Key words
smart, smartdigest, digestadalimumab, adalimumabdigestion, digestionmagnetic, magneticmodifications, modificationsalternative, alternativepeptide, peptiderapid, rapidmapping, mappingdeamidation, deamidationrelative, relativenistmab, nistmabinduced, inducedsample