SMART Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization

Applications | 2016 | Thermo Fisher ScientificInstrumentation
Sample Preparation, LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
Industries
Proteomics
Manufacturer
Thermo Fisher Scientific

Summary

Significance of the Topic


Peptide mapping is a cornerstone technique in biopharmaceutical development and quality control, providing detailed characterization of therapeutic monoclonal antibodies (mAbs). Rapid and reproducible proteolytic digestion is critical to obtain complete sequence coverage and accurate profiling of post-translational modifications (PTMs), such as deamidation, oxidation, glycosylation, and carbamylation, which can affect product safety and efficacy.

Study Objectives


The study aimed to compare a novel SMART Digest kit protocol with two classic in-solution digestion workflows (urea- and heat-based denaturation) for rituximab peptide mapping. Key objectives included:
  • Assessing sequence coverage of heavy and light chains
  • Evaluating reproducibility and digestion completeness
  • Quantifying common PTMs (deamidation, oxidation, glycosylation, carbamylation)
  • Determining optimal digestion times to minimize artificial modifications

Methodology and Instrumentation


Sample preparation and digestion protocols:
  • In-solution (urea): Denaturation in 7 M urea, reduction with DTT, alkylation with IAA, overnight trypsin digest at 37 °C
  • In-solution (heat): Denaturation at 70 °C, reduction and alkylation, overnight trypsin digest at 37 °C
  • SMART Digest kit: Dilution with proprietary buffer, immobilized trypsin digestion at 70 °C for 15–75 min

Liquid chromatography–mass spectrometry:
  • UHPLC: Thermo Scientific Vanquish Flex Quaternary system with Acclaim VANQUISH C18 (2.1 × 250 mm, 2.2 µm), gradient elution at 0.3 mL/min, 50 °C
  • MS: Thermo Scientific Q Exactive HF hybrid Quadrupole-Orbitrap, full MS (m/z 140–2000, 60 000 FWHM), data-dependent MS2 (15 000 FWHM, top-5)
  • Data analysis: Chromeleon 7.2 for acquisition, BioPharma Finder 1.0 for peptide/PTM identification with 5 ppm mass tolerance

Main Results and Discussion


  • Sequence coverage: All six workflows achieved 100% coverage of heavy and light chains; SMART Digest reached complete coverage within 15 min
  • Reproducibility: SMART Digest triplicate digests showed average RSD <5% for peak areas across operators and days
  • Peptide maps: Total ion chromatograms and mirror plots indicated highly similar peptide patterns between SMART Digest (75 min) and classical methods
  • PTM profiling: Identified 85 modifications including glycoforms at N301, deamidations (n=7), oxidations (n=12), glycation, carbamylation
  • Modification rates: SMART Digest (15 min) exhibited the lowest deamidation and oxidation factors; extended incubations (>45 min) increased deamidation
  • Carbamylation: Virtually absent in SMART Digest samples due to omission of urea, whereas classic urea digests showed up to ~1% lysine carbamylation

Benefits and Practical Applications


  • Significant time savings: 15 min digestion versus overnight protocols
  • High reproducibility: RSD <5% supports robust QC workflows
  • Reduced artefacts: Lower induced deamidation and carbamylation at optimized conditions
  • Workflow integration: Seamless coupling with UHPLC–Orbitrap for automated peptide mapping

Future Trends and Applications


Emerging directions include:
  • High-throughput screening: Integration of rapid digestion kits in 96-well formats
  • Automation: Robotic liquid-handling for end-to-end peptide mapping
  • AI-driven data analysis: Enhanced PTM identification and quantification using machine learning
  • Biosimilarity assessment: Fast comparability studies for biosimilar mAbs

Conclusion


The SMART Digest kit paired with Vanquish Flex and Q Exactive HF offers a fast, reproducible, and comprehensive alternative to classical in-solution digestion methods for mAb peptide mapping. It delivers complete sequence coverage in as little as 15 minutes while maintaining accurate PTM profiling and minimizing artifactual modifications, streamlining biopharmaceutical characterization workflows.

Reference


  1. Ren D, Pipes GD, Liu D, et al. An improved trypsin digestion method minimizes digestion-induced modifications on proteins. Anal Biochem. 2009;392:12–21.
  2. Thermo Scientific SMART Digest Kit Technical Guide. Runcorn, UK; 2015.
  3. Thermo Scientific Application Note 21198: Improvement in Speed and Reproducibility of Protein Digestion and Peptide Quantitation, Runcorn, UK; 2015.
  4. Nebija D, Kopelent-Frank H, Urban E, et al. Comparison of two-dimensional gel electrophoresis patterns of therapeutic mAbs trastuzumab and rituximab. J Pharm Biomed Anal. 2011;56:684–91.
  5. Kollipara L, Zahedi RP. Protein carbamylation: in vivo modification or in vitro artefact? Proteomics. 2013;13:941–944.
  6. Dick LW, Mahon D, Qiu D, Cheng KC. Peptide mapping of therapeutic mAbs: improvements for increased speed and fewer artifacts. J Chromatogr B. 2009;877:230–236.
  7. Visser J, Feuerstein I, Stangler T, et al. Physicochemical and functional comparability between biosimilar rituximab GP2013 and originator rituximab. BioDrugs. 2013;27:495–507.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
SMART Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization
APPLICATION NOTE Authors: Martin Samonig1, Alexander Schwahn2, Ken Cook3, Mike Oliver4, and Remco Swart1 Thermo Fisher Scientific, Germering, Germany; 2Thermo Fisher Scientific, Basel, Switzerland; 3Thermo Fisher Scientific, Hemel Hempstead, United Kingdom; 4 Thermo Fisher Scientific, Runcorn, United Kingdom 1 Key…
Key words
smart, smartdigest, digestdigestion, digestiondeamidation, deamidationurea, ureamodifications, modificationscarbamylation, carbamylationrituximab, rituximabpeptide, peptideabundance, abundancemodification, modificationrelative, relativeheat, heatscientific, scientificsolution
SMART Digest Peptide Mapping and Quantitation Compendium
Table of Contents Introduction Faster and More Sensitive Protein Characterization and Quantitation Easier Digestion Faster Digestion Highly Reproducible Digestion Automation of Digestion Improving Sensitivity and Speed SMART Digest Peptide Mapping and Quantitation Compendium Peptide Mapping Peptide Quantitation Product and Method…
Key words
mapping, mappingpeptide, peptidedigestion, digestionsmart, smartmodifications, modificationsdigest, digestchain, chainposttranslational, posttranslationalheavy, heavymonoclonal, monoclonaltrypsin, trypsinantibodies, antibodiesthroughput, throughputprotein, proteinautomated
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestprime, primeduo, duomagnetic, magneticsrwqqgnvfscsvmhealhnhytqk
Comparison of alternative approaches to trypsin protein digestion for reproducible and efficient peptide mapping analysis of monoclonal antibodies
APPLICATION NOTE 21782 Comparison of alternative approaches to trypsin protein digestion for reproducible and efficient peptide mapping analysis of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Noemi Dorival-García, Nicola McGillicuddy, Sara Carillo, Amy Farrell, Jonathan Bones National Institute for Bioprocessing…
Key words
smart, smartdigest, digestadalimumab, adalimumabdigestion, digestionmagnetic, magneticmodifications, modificationsalternative, alternativepeptide, peptiderapid, rapiddeamidation, deamidationmapping, mappingrelative, relativenistmab, nistmabinduced, inducedsample
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike